T 0932/04 (HIV-Virus/SIEMENS) of 30.4.2009

European Case Law Identifier: ECLI:EP:BA:2009:T093204.20090430
Datum der Entscheidung: 30 April 2009
Aktenzeichen: T 0932/04
Anmeldenummer: 93116058.4
IPC-Klasse: C12N 7/00
Verfahrenssprache: DE
Verteilung: D
Download und weitere Informationen:
Text der Entscheidung in DE (PDF, 78.922K)
Alle Dokumente zum Beschwerdeverfahren finden Sie im Register
Bibliografische Daten verfügbar in: DE
Fassungen: Unpublished
Bezeichnung der Anmeldung: Retrovirus aus der HIV-Gruppe und dessen Verwendung
Name des Anmelders: Siemens Healthcare Diagnostics Products GmbH
Name des Einsprechenden: 1) Chiron Corporation
2) Institut Pasteur
3) BIO-RAD PASTEUR
4) Ortho Clinical Diagnostics, Inc.
6) BIOTEST AG
Kammer: 3.3.08
Leitsatz: -
Relevante Rechtsnormen:
European Patent Convention Art 54
European Patent Convention Art 56
European Patent Convention Art 83
European Patent Convention Art 84
European Patent Convention Art 123(2)
Schlagwörter: Hauptantrag - Zulässigkeit der Änderungen (ja)
Klarheit (ja)
Ausführbarkeit der Erfindung (ja)
Neuheit (ja)
Erfinderische Tätigkeit (ja)
Orientierungssatz:

-

Angeführte Entscheidungen:
-
Anführungen in anderen Entscheidungen:
-

Sachverhalt und Anträge

I. Die Beschwerden der Patentinhaberin (Beschwerdeführerin I) und der Einsprechenden 02 (Beschwerdeführerin II), 03 (Beschwerdeführerin III) und 06 (Beschwerdeführerin IV) richten sich gegen die Zwischenentscheidung der Einspruchsabteilung vom 27. Mai 2004, mit der das europäische Patent Nr. 0 591 914 in geändertem Umfang auf Basis der Ansprüche 1 bis 11 des während der mündlichen Verhandlung vor der Einspruchsabteilung am 4. März 2004 eingereichten Hilfsantrags III aufrechterhalten wurde. Die Einspruchsabteilung kam zur Schlussfolgerung, dass der Hauptantrag (Ansprüche wie erteilt) und der damals vorliegende Hilfsantrag I gegen Artikel 123 (2) EPÜ verstießen und dass der Hilfsantrag II die Erfordernisse des Artikels 83 EPÜ nicht erfüllte.

II. Das Patent, das die Prioritäten der am 6. Oktober 1992, 22. Oktober 1992, 30. Dezember 1992 und 1. Juni 1993 eingereichten Anmeldungen DE 4233646, DE 4235718, DE 4244541 und DE 4318186 beansprucht, war auf die europäische Anmeldung Nr. 93 116 058.4 erteilt worden, die am 5. Oktober 1993 mit der Bezeichnung "Retrovirus aus der HIV-Gruppe und dessen Verwendung" eingereicht worden war.

III. Gegen die Erteilung des Patents waren sechs Einsprüche eingelegt worden, die sich auf Einspruchsgründe gemäß Artikel 100 a) EPÜ 1973, nämlich mangelnde Neuheit und fehlende erfinderische Tätigkeit, Artikel 100 b) EPÜ 1973 (keine ausreichende Offenbarung) sowie Artikel 100 c) EPÜ 1973 (unzulässige Änderungen) stützten.

IV. Die Einsprechenden 01, 04 und 05 zogen ihre Einsprüche jeweils am 30. Juni 2004, 28. Juni 2004 und 19. Oktober 2001 zurück und sind deswegen an diesem Beschwerdeverfahren nicht beteiligt.

V. Alle Beschwerdeführerinnen reichten fristgemäß ihre Beschwerdebegründung ein. Mit ihrer Beschwerdebegründung reichte die Beschwerdeführerin I am 27. September 2004 einen Hilfsantrag (Ansprüche 1 bis 17) ein. Mit ihrer Beschwerdebegründung legte die Beschwerdeführerin III einen Versuchsbericht (D48; s. Nr. XV) vor.

VI. Es folgte ein Briefwechsel zwischen den Parteien als Reaktion auf die jeweiligen Stellungnahmen, nämlich:

a) am 16. September 2005 seitens der Beschwerdeführerin III und am 19. September 2005 seitens der Beschwerdeführerin II, beide mit weiteren Versuchsergebnissen;

b) am 28. November 2005 seitens der Beschwerdeführerin I mit zwei Versuchsberichten (D51 und D52; s. Nr. XV);

c) am 20. Februar 2006 seitens der Beschwerdeführerin III;

d) am 15. März 2006 seitens der Beschwerdeführerin I mit zwei weiteren Versuchsberichten (D58 und D59; s. Nr. XV);

e) am 30. Juni 2006 seitens der Beschwerdeführerin III mit einem weiteren Versuchsbericht (D62; s. Nr. XV);

f) am 11. Oktober 2006 seitens der Beschwerdeführerin I mit einem weiteren Versuchsbericht (D65; s. Nr. XV);

g) am 8. Januar 2007 seitens der Beschwerdeführerin III;

h) am 5. April 2007 seitens der Beschwerdeführerin I mit einem weiteren Versuchsbericht (D66; s. Nr. XV) und

i) am 26. Juni 2007 seitens der Beschwerdeführerin III.

VII. Eine Mitteilung nach Artikel 15 (1) der Verfahrensordnung der Beschwerdekammern (VOBK) wurde den Beteiligten am 15. April 2008 zugesandt.

VIII. In Antwort darauf reichten die Beschwerdeführerinnen I, II und III weitere Stellungnahmen ein. Die Beschwerdeführerin I legte auch einen Hauptantrag (Ansprüche wie erteilt) und Hilfsanträge I bis IV vor und reichte weitere Dokumente ein, darunter D80 (s. Nr. XV).

IX. Während der mündlichen Verhandlung am 7. Oktober 2008 reichte die Beschwerdeführerin I einen neuen Hauptantrag ein, der, nachdem keine formalen Einwände mehr bestanden, im Hinblick auf die Frage erörtert wurde, ob der beanspruchte Gegenstand in der Patentschrift ausreichend offenbart sei (Art. 83 EPÜ). Am Ende der mündlichen Verhandlung erklärte die Kammer nach Beratung, dass das Verfahren schriftlich weitergeführt werde.

X. Der Hauptantrag vom 7. Oktober 2008 besteht aus zwölf Ansprüchen.

Anspruch 1 und die davon abhängigen Ansprüche 2 und 3 entsprechen den Ansprüchen 1 bis 3 wie erteilt, wobei Anspruch 1 wie folgt lautet:

"1. Immunschwäche-Virus der HIV-Gruppe, das bei der European Collection of Animal Cell Cultures (ECACC) unter der Nr. V 920 92 318 mit der Bezeichnung MVP-5180/91 hinterlegt wurde, sowie Varianten des Virus, wobei eine Variante eine Sequenz aufweist, die der Tabelle 3 entspricht oder zu dieser Sequenz homolog ist, wobei die Homologie mehr als 66 % bezogen auf die Nukleotidsequenz beträgt."

Anspruch 4 lautet wie folgt:

"4. Testkit zum Nachweis von Antikörpern gegen Immunschwäche verursachende Viren, die einer unabhängigen Gruppe von HIV-Viren gemäß Anspruch 1 bis 3 angehören, worin ein Antigen eingesetzt wird, das eine Aminosäuresequenz oder Aminosäureteilsequenz aufweist, die von einem derartigen Virus abgeleitet ist, und die der Tabelle 3 oder einer Teilsequenz davon entspricht und die Teilsequenz wenigstens 6 Aminosäuren aufweist."

Die Ansprüche 5 bis 9 sind von Anspruch 4 abhängig und betreffen besondere Ausführungsformen des Testkits.

Anspruch 10 lautet wie folgt:

"10. Verwendung eines von dem bei der European Collection of Animal Cell Cultures (ECACC) unter der Nr. V 920 92 318 mit der Bezeichnung MVP-5180/91 hinterlegten Virus abgeleiteten Antigens zum Nachweis von Retroviren, die Immunschwäche verursachen und die einer unabhängigen Gruppe von HIV-Viren gemäß Anspruch 1 angehören."

Die von Anspruch 10 abhängigen Ansprüche 11 und 12 betreffen besondere Ausführungsformen der Verwendung.

XI. Eine weitere Mitteilung der Kammer wurde den Beteiligten zugesandt. Darin äußerte die Kammer die Auffassung, dass Anspruch 1 den Erfordernissen des Artikels 83 EPÜ nicht genüge und dass die Debatte hinsichtlich dieses Artikels für den Hauptantrag geschlossen sei.

XII. In Erwiderung auf die Mitteilung der Kammer reichte die Beschwerdeführerin I zwei Schreiben ein. In dem Schreiben vom 20. Januar 2009, dem acht neue Literaturstellen (darunter D87 und D89; s. Nr. XV) und eine Erklärung (s. D93 unter Nr. XV) beigefügt wurden, vertrat die Beschwerdeführerin I die Auffassung, dass die in der Mitteilung der Kammer geäußerte Aussage "Für den Hauptantrag ist die Debatte hinsichtlich Artikel 83 geschlossen" eine Verletzung des rechtlichen Gehörs (Art. 113 (1) EPÜ) darstelle.

Mit dem Schreiben vom 20. März 2009 wurden sechzehn zusätzliche Hilfsanträge (Hilfsanträge V bis XX), eine Erklärung (s. D94 unter Nr. XV), zwei neue Literaturstellen (s. D95 und D96 unter Nr. XV) und ein weiterer Versuchsbericht eingereicht.

XIII. Die Beschwerdeführerinnen II und III erwiderten auf die Mitteilung der Kammer mit Schreiben vom 25. bzw. 19. März 2009.

XIV. Eine zweite mündliche Verhandlung fand am 29. und 30. April 2009 statt. Am Anfang der mündlichen Verhandlung wurde die Debatte hinsichtlich des Hauptantrags wiedereröffnet und dessen Zulässigkeit nach Artikel 83 EPÜ diskutiert. In der Verhandlung wurden alle vor der früheren mündlichen Verhandlung vom 7. Oktober 2008 eingereichten Dokumente sowie die Dokumente D87, 89 und 93 bis 96 (s. Nr. XV) zugelassen. Am Ende der mündlichen Verhandlung wurden alle Hilfsanträge zurückgezogen.

XV. In der vorliegenden Entscheidung wird auf die folgenden Schriftstücke Bezug genommen:

(D1) EP-A1-0 345 375 (veröffentlicht am 13. Dezember 1989)

(D4) L. G. Gürtler et al., Journal of Virology, Bd. 68, Nr. 3, März 1994, Seiten 1581 bis 1585

(D11) J. W. Gnann et al., Science, Bd. 237, 11. September 1987, Seiten 1346 bis 1349

(D12) J. W. Gnann et al., Journal of Virology, Bd. 61, Nr. 8, August 1987, Seiten 2639 bis 2641

(D15) T. Rehle et al., Int. Conf. AIDS (Niederlande) 19. bis 24. Juli 1992, Proceedings, Bd. 8, Nr. 3, Seite 34, Zusammenfassung Nr. PuA 6138

(D26) 4. Deutscher AIDS-Kongress, Programm und Zusammenfassungen, Wiesbaden, 25. bis 28. März 1992, ISBN 3-923599-70-6, Zusammenfassung 289

(D28) J. W. Gnann et al., The Journal of Infectious Diseases, Bd. 156, Nr. 2, August 1987, Seiten 261 bis 267

(D34) Verschiedene Sequenzvergleiche zwischen MVP-5180 und LaV-env bzw. BH10-env (vorgelegt von der Beschwerdeführerin IV mit dem Einspruch)

(D37) "Human Retroviruses and AIDS 1998", Edited by B. Korber et al., veröffentlicht durch Theoretical Biology and Biophysics, Los Alamos, Seite I-A-12, Dezember 1998, Abstract ADI_2R.MAL

(D48) Anlage B zur Beschwerdebegründung der Beschwerdeführerin III (Versuchsbericht von Bio-Rad Pasteur)

(D51) Anlage I zum Brief der Beschwerdeführerin I vom 28. November 2005 (Versuchsbericht Teil 1)

(D52) Anlage II zum Brief der Beschwerdeführerin I vom 28. November 2005 (Versuchsbericht Teil 2)

(D56) Versuchsberichte der Beschwerdeführerin III im Rahmen ihres Einspruchs gegen EP 0 657 532

(D58) Anlage zum Brief der Beschwerdeführerin I vom 15. März 2006 (Versuchsbericht Teil 1)

(D59) Anlage zum Brief der Beschwerdeführerin I vom 15. März 2006 (Versuchsbericht Teil 2)

(D60) H. M. Geysen et al., Proc. Natl. Acad. Sci. USA, Bd. 81, Juli 1984, Seiten 3998 bis 4002

(D61) Brief der ECACC vom 8. Oktober 2004 an Dr. M. Van den Haesevelde

(D62) Versuchsbericht der Beschwerdeführerin III, eingereicht mit Brief vom 30. Juni 2006

(D65) Versuchsbericht der Beschwerdeführerin I, eingereicht mit Brief vom 11. Oktober 2006 (Versuchsbericht Teil 5)

(D66) Versuchsbericht der Beschwerdeführerin I, eingereicht mit Brief vom 5. April 2007 (Versuchsbericht Teil 6)

(D68) L. G. Fägerstam et al., Journal of Molecular Recognition, Bd. 3, Nr. 5/6, 1990, Seiten 208 bis 214

(D69) EP-B1-0 239 425 (am 2. November 1989 erteilt)

(D79) L.G. Gürtler et al., Journal of Virological Methods, Bd. 51, 1995, Seiten 177 bis 184

(D80) Erklärung von Dr. K. Hofmann vom 1. August 2008

(D87) J. H. M. Cohen et al., The Lancet, Bd. 345, 1. April 1995, Seiten 856 bis 857

(D89) A. Ayouba et al., Emerging Infectious Diseases, Bd. 7, Nr. 3, Mai-Juni 2001, Seiten 466 bis 467

(D93) Bericht von Dr. K. Hofmann (Miltenyi Biotec GmbH) mit Abbildungen 1 bis 3 in den Anlagen D93a bis c

(D94) Erklärung von Dr. B. Fleckenstein vom 21. Januar 2009

(D95) T. Muster et al., Journal of Virology, Bd. 67, Nr. 11, November 1993, Seiten 6642 bis 6647

(D96) X. Dong et al., Immunology Letters, Bd. 101, 2005, Seiten 104 bis 107

XVI. Das Vorbringen der Beschwerdeführerin I, soweit es für die vorliegende Entscheidung relevant ist, lässt sich wie folgt zusammenfassen:

Artikel 123 (2) EPÜ

Anspruch 4 finde Stützung im ursprünglichen Anspruch 23 zusammen mit den Ansprüchen 1 bis 11, 13 und 21.

Artikel 83 EPÜ

Ansprüche 1 bis 3

Der Kern der vorliegenden Erfindung sei die Identifizierung und nacharbeitbare Beschreibung eines ganz speziellen HIV-Stammes, der sich von den vorbekannten HIV-Stämmen unterscheide und aufgrund dieser Besonderheiten diagnostisch vor dem Zeitpunkt der vorliegenden Erfindung nicht zuverlässig nachgewiesen werden konnte. Durch die herausragende Leistung der Erfinder sei der HIV-Stamm MPV-5180 identifiziert, isoliert und komplett sequenziert worden, und es seien auf Basis der Sequenz hergestellte Antigene der diagnostisch relevanten Bereiche des Virus zur Verfügung gestellt worden.

Es sei für den einschlägigen Durchschnittsfachmann völlig selbstverständlich, dass die genaue Charakterisierung eines speziellen Virus bzw. einer Gruppe von Viren auf molekularer Ebene, also anhand der Nukleinsäuresequenz und/oder Aminosäuresequenz, bevorzugt werde, sofern dies möglich sei.

Biochemische, immunologische oder morphologische Eigenschaften möchten zwar auch zur Unterscheidung von verschiedenen Viren geeignet sein. Für die Unterscheidung innerhalb einer einzigen Virenart seien sie jedoch nicht geeignet, weil auf dieser Ebene die Unterschiede oft nicht deutlich erkennbar oder so gering seien, dass sie für eine sichere Unterscheidung nicht ausreichten. Die genaueste Unterscheidung erfolge über die Nukleinsäuresequenz, und die Sequenzhomologie zwischen Virusstämmen sei das beste Kriterium (s. z. B. Dokument D94, S. 2, erster Absatz).

Im vorliegenden Fall sei der eindeutige Parameter der Sequenzhomologie angegeben, wodurch die Varianten des hinterlegten Virus klar definiert würden. Der Ausdruck "Variante" sei in der Patentschrift an mehreren Stellen erläutert. Der Fachmann wisse aufgrund dieser Erläuterungen und der Definition über die Homologie zur Sequenz der Tabelle 3 genau, was darunter zu verstehen sei. Dokument D80 belege eindeutig, dass das Kriterium der mehr als 66%igen Sequenzhomologie bezogen auf die Tabelle 3 ausreichend sei, um eine eindeutige Entscheidung zu erlauben, ob ein gegebenes HI-Virus zu den Varianten des hinterlegten Stammes gehöre. Somit sei die beanspruchte Erfindung auch im Bereich der Varianten nacharbeitbar.

Ansprüche 4 bis 12

Durch die vorgelegten Vergleichsversuche (s. Dokumente D51, D52, D58, D59, D65 und D66) sei durchaus glaubhaft gemacht, dass die beanspruchte Erfindung über den gesamten Bereich ausreichend offenbart sei, und dass auch kurze Peptide sehr wohl dazu geeignet sein könnten, eine diagnostische Aussage zu treffen.

Was die bezüglich der Nacharbeitbarkeit eines Epitops mit wenigstens 6 Aminosäuren entgegengehaltene Offenbarung von Gnann et al. (s. Dokumente D11 und D12) angehe, werde die Korrektheit der Aussagen von Gnann et al. nicht bestritten. Diese müssten allerdings mit den Augen des Fachmanns gelesen werden. Betrachte man beispielweise die Tabelle 2 von Dokument D12 (S. 2640, linke Spalte, unten), so stelle man fest, dass der prozentuale Anteil der positiven Reaktionen bei den Peptiden SGKLIC, LWGCSGKL oder LGLWGC 0 % betrage, wogegen bei dem Heptapeptid CSGKLIC ein Anteil von 48 % positiven Reaktionen festgestellt werde. Die fundierte Erläuterung finde sich hierfür auf Seite 2640, linke Spalte: "[...] (ii) the essential epitope for immune recognition is a 7-amino-acid sequence containing two cysteine residues (amino acids 603-609; Cys-Ser-Gly-Lys-Leu-Ile-Cys); and (iii) the presence of both cysteine residues is essential for the antigenic conformation of the epitope, possibly via formation of disulfide bonds.". Die Aussage von Gnann et al. besage nicht, dass es keine Hexapeptide gebe, die ein Epitop beinhalten.

Zum Beleg dafür, dass es grundsätzlich möglich sei, dass ein Epitop nur 6 Aminosäuren umfasse, seien im vorliegenden Verfahren mehrere Versuchsberichte eingereicht worden, u. a. D66, worin die sogenannte "Surface Plasmon Resonance"-Technik verwendet worden sei, die vor dem Prioritätstag des angegriffenen Patents allgemein verfügbar gewesen sei (s. z. B. Dokument D68). Darin sei gezeigt worden, dass mit einem Hexapeptid tatsächlich Antikörper aus dem Serum eines mit einem HIV-Subtyp O, zu dem der hinterlegte Stamm gehöre, infizierten Patienten nachgewiesen werden könnten.

In Ergänzung dazu wurde auch auf die nachveröffentlichten Dokumente D95 und D96 verwiesen, die eindeutig belegten, dass es auch bei HI-Viren Polypeptide mit Epitopen gebe, die nur 6 Aminosäuren umfassten. Dokument D96 erwähne die Epitope ELDKWA, NWFDIT und ERDRDR, die durch geeignete monoklonale Antikörper identifiziert würden. Darin sei auch das offensichtlich HIV-O-spezifische ELDEWA erwähnt (s. S. 105, linke Spalte, letzter Satz des ersten Abschnitts).

Neuheit (Art. 54 EPÜ)

Dokument D1 offenbare eine env-Sequenz, die völlig verschieden sei von der Sequenz des vorliegenden Patents. Hierfür gebe es nur zwei Erklärungsmöglichkeiten. Entweder offenbare Dokument D1 einen anderen Organismus oder die env-Sequenz sei fehlerhaft. Von den Einsprechenden sei zu dieser Frage keine überzeugende Erklärung vorgelegt oder eine Festlegung auf eine der Alternativen getroffen worden. Die Hinterlegung könne nicht als Surrogat für die Offenbarung gelten, weil die Hinterlegung in vielerlei Hinsicht fehlerhaft sei.

Erfinderische Tätigkeit (Art. 56 EPÜ)

Die vorliegende Erfindung beruhe im Kern darauf, dass es der Patentinhaberin gelungen sei, einen Vertreter einer neuen Gruppe von HI-Viren aufzufinden. Es habe früher verschiedene, erfolglose Versuche gegeben, Viren einer neuen HIV-1-Gruppe zu isolieren und zu identifizieren. Dies habe zu überraschenden und vorteilhaften Auswirkungen auf die Diagnose geführt. Durch die Offenbarung des Virus und dessen kompletter Sequenz sei es für den Fachmann möglich, Infektionen von derartigen Viren nachzuweisen, die ohne die Offenbarung der vorliegenden Erfindung unentdeckt geblieben wären. Dass es in solchen Fällen zu Infektionen mit AIDS bei Bluttransfusionen kommen könne, zeige die Bedeutung der vorliegenden Erfindung.

XVII. Das Vorbringen der Beschwerdeführerinnen II und III, soweit es für die vorliegende Entscheidung relevant ist, lässt sich wie folgt zusammenfassen:

Artikel 123(2) EPÜ

Der vorliegende Anspruch 4 sei durch den Anspruch 23 in der ursprünglich eingereichten Fassung nicht ausreichend gestützt, wenn man ihn rückbezogen auf die Ansprüche 21, 13, 11 und 1 bis 10 lese, denn diese beträfen Virusvarianten, die anders als diejenigen der vorliegenden Ansprüche 1 bis 3 definiert seien.

Klarheit (Art. 84 EPÜ)

Es sei nicht klar, ob das in einem Testkit enthaltene Antigen gemäß Anspruch 4 einen nicht-viralen Anteil enthalte.

Nicht ausreichende Offenbarung der Varianten (Art. 83 EPÜ)

Ansprüche 1 bis 3

In dem Patent sei keine bestimmte Variante offenbart. Das Patent beschreibe nicht den Subtyp O von Viren, der erst nach dem Anmeldetag definiert worden sei.

Damit ein neues Isolat von HIV-1 als Variante des Isolats MVP-5180/91 gelten könne, sei das einzige Kriterium gemäß den Ansprüchen 1 bis 3, dass in einer zu seiner genomischen RNS komplementären DNS eine Sequenz vorliege, die entweder der Sequenz in der Tabelle 3 des Patents entspreche oder eine Homologie von über 66 % (Anspruch 1), über 75 % (Anspruch 2) oder sogar über 85 % (Anspruch 3) zu ihr aufweise.

Ein solches Kriterium biete dem Fachmann keine ausreichende Anleitung, weil es als solches technisch irrelevant und nicht sachdienlich sei. Dies zeige sich in der Tatsache, dass die Sequenz der Tabelle 3 für kein bestimmtes charakteristisches Protein codiere, sondern für ein chimäres Peptid, das aus einem Abschnitt von Aminosäuren des C-terminalen Bereichs des gp120-Proteins bestehe, der mit gp41 an dessen N-terminalem Bereich fusioniert sei, wobei die technische Relevanz hiervon nicht offenbart sei. Die Untergrenze der "Homologie von 66 %" sei willkürlich gewählt worden. In der Beschreibung gebe es keine Begründung für die Wahl dieses Grenzwerts, ab dem ein neues Isolat als Variante des Stamms MVP-5180/91 klassifiziert werde. Der Wert von 66 % solle in Beispiel 5 nur angeben, dass die Nukleotidsequenz der Tabelle 1 des Patents, die einen Teil der Sequenz der Tabelle 3 darstelle, im besten Fall eine Homologie von 66 % mit der entsprechenden Sequenz aufweise, die man aus einem Virusisolat von einem Schimpansen erhalte.

Ein solches Kriterium sei im Stand der Technik oder in den nachveröffentlichten Druckschriften niemals erwähnt worden, auch nicht in den Veröffentlichungen, zu denen die Erfinder beigetragen hätten, um HIV-Viren zu klassifizieren.

Die Ansprüche 1 bis 3 enthielten keine positiven technischen Schlüsselmerkmale struktureller, immunologischer und morphologischer Art für das Isolat MVP-5180/91, die zwangsläufig in einem neuen Isolat vorhanden sein müssten, damit es vom Fachmann als Variante dazu erkannt werde. Damit man ohne unzumutbaren Aufwand entscheiden könne, ob ein bestimmtes Isolat zur Gruppe der Varianten eines bestimmten Virus gehöre, solle diese Gruppe anhand ihrer biologischen und morphologischen Merkmale, durch die strukturellen Merkmale ihrer Proteine und ihre gesamten immunologischen Eigenschaften sowie durch ihre mangelnde Amplifikation mit Primern von bekannten Viren definiert werden. Die genannten Ansprüche bezögen sich nicht auf diese multiplen Eigenschaften, sondern beruhten nur auf der Homologie zu einer willkürlich gewählten Sequenz.

Ansprüche 4 bis 9

Im Patent seien kein Testkit oder Versuche mit Antigenen des hinterlegten Virus oder Varianten davon beschrieben, geschweige denn ein Immunoassay mit einem Peptid, das die Sequenz der Tabelle 3 oder einen Teil davon enthalte oder daraus bestehe. Die einzigen Tests, über die im Versuchsteil der Beschreibung berichtet werde, beträfen das gesamte Virus oder das gesamte gp41-Protein.

Was die experimentellen Versuche angehe, die die Beschwerdeführerin I in den Dokumenten D51, D52, D58, D59, D65 and D66 eingereicht habe, so seien diese aufgrund von Testmängeln nicht überzeugend, insbesondere wegen der Verwendung einer zu kleinen Zahl von positiven Seren zum Testen der Peptide und wegen der Wahl der Methoden, die im Patent nicht beschrieben würden, am Anmeldetag nicht zur Verfügung gestanden hätten, zu kompliziert oder im Bereich der Immunologie nicht üblich seien.

Bei diesen Versuchen seien Peptide getestet worden, die von nur zwei Bereichen der Aminosäuresequenz der Tabelle 3 des Patents abgeleitet seien, nämlich dem N-terminalen Bereich mit der Sequenz MSRPIINIHTPHREKRAVGLGMLFLGVLSAAGSTMGAAA und dem Bereich mit der Sequenz RLQALETLIQNQQRLNLWGCKGKLICYTSVKWNTS (beginnend beim Argininrest an Position 84 und endend mit dem Serinrest an Position 118).

Von 11 Hexameren, die von der Sequenz MSRPIINIHTPHREKR des ersten Bereichs abgeleitet seien, habe nur eines positiv reagiert (mit nur einem positiven Serum), und von 30 Hexameren, die vom zweiten Bereich abgeleitet seien, hätten nur 10, einschließlich KGKLIC, positiv reagiert (s. Dokumente D51, D52, D58, D59, D62, D65 und D66).

Das 23-mer-Peptid mit der Sequenz AVGLGMLFLGVLSAAGSTMGAAA des ersten Bereichs sowie 3 Peptide, die vom zweiten Bereich abgeleitet seien, nämlich das 15-mer QQRLNLWGCKGKLIC, das 35-mer RLQALETLIQNQQRLNLWGCKGKLICYTSVKWNTS und das 22-mer NQQRLNLWGCKGKLICYTSVKWN, seien getestet worden und hätten positiv reagiert (s. Dokumente D52, D58 und D66).

Diese Ergebnisse - sofern sie überhaupt als gültig zu betrachten seien - reichten nicht für den Nachweis aus, dass die Erfindung über den gesamten Schutzumfang des Anspruchs ausgeführt werden könne. Die Beschwerdeführerin I habe in ihren Experimenten nicht gezeigt, dass ein Peptid, insbesondere ein Hexamer, das von einem Teil der Aminosäuresequenz der Tabelle 3 abgeleitet sei, als Antigen in einem Routinetestkit des Anspruchs 4 verwendet werden könne, um das Isolat MVP-5180/91 oder Varianten davon nachzuweisen. Im Hinblick auf KGKLIC seien die positiven Ergebnisse nicht glaubwürdig, weil sie der in den Dokumenten D11 und D12 enthaltenen "Lehre von Gnann et al." widersprächen.

Aus demselben Grund sei auch der Gegenstand der abhängigen Ansprüche 5 bis 9 nicht ausreichend offenbart. Gegen Anspruch 8 sei ferner einzuwenden, dass ein Western Blot nicht mit einem Peptid durchgeführt werden könne, das nur die Länge eines Hexamers habe.

Ansprüche 10 bis 12

Die Verwendung eines vom Isolat MVP-5180/91 abgeleiteten Antigens zum Nachweis von Retroviren gemäß Anspruch 10 sei in dem Patent nicht beschrieben, das außerdem keinerlei Angaben zu einem geeigneten Antigen enthalte, das von den durch das virale Genom codierten Proteinen abgeleitet werden könne.

Deshalb sei der Fachmann nicht in der Lage, ein Antigen gemäß den Ansprüchen 10 bis 12 ohne unzumutbaren Aufwand zu verwenden.

Neuheit (Art. 54 EPÜ)

Wenn - wie die Beschwerdeführerin I anscheinend behaupte - Anspruch 1 alle Stämme der HIV-1-Gruppe O umfasse, schließe er auch den ANT-70-Stamm gemäß Dokument D1 ein, dessen Nukleotidsequenz eine Homologie von 85 % zu der des Isolats MVP-5180/91 aufweise. Selbst wenn die Hinterlegung des ANT-70-Stamms gemäß Dokument 1 als ungültig zu betrachten sei, sei die Offenbarung von Varianten davon in diesem Dokument nacharbeitbar. Deshalb seien die Ansprüche 1 bis 3 gegenüber Dokument D1 nicht neu.

Erfinderische Tätigkeit (Art. 56 EPÜ)

Ansprüche 1 bis 3

Dokument D1, das auf die Existenz atypischer HIV-Stämme hindeute, die nicht mit Antikörpern gegen die HIV-1- und HIV-2-Stämme aus dem Stand der Technik reagierten, könne als nächstliegender Stand der Technik betrachtet werden.

Von Dokument D1 ausgehend könne als der Erfindung zugrunde liegende technische Aufgabe die Identifizierung eines solchen atypischen Stamms betrachtet werden. Deshalb stelle sich die Frage, ob andere Dokumente aus dem Stand der Technik oder eine Kombination daraus dem Fachmann die geeigneten Mittel dazu bereitgestellt hätten.

Da die Verfahren gemäß Dokument D69, das die Identifizierung des ersten HIV-2-Stamms beschreibe, den im Patent verwendeten entsprächen, bestehe kein Zweifel, dass der Fachmann, der das Dokument D69 kenne, in der Lage gewesen wäre, einen solchen atypischen Stamm zu identifizieren. Die Relevanz des Dokuments D69 werde gestützt von der Aussage im nachveröffentlichten Dokument D79 (s. S. 182, Abschnitt 4, 3. Absatz), zu dem zwei der Erfinder beigetragen hätten, dass die Testsituation für die HIV-1-Gruppe O Ähnlichkeiten mit der Situation aufweise, als HIV-2 im Jahre 1986 entdeckt worden sei und einige der Anti-HIV-2-Proben nicht durch ausschließlich auf HIV-1 basierenden Assays hätten ermittelt werden können.

Das einzige in Anspruch 1 genannte technische Merkmal für die Kennzeichnung der Varianten des Isolats MVP-5180/91, nämlich die Homologie von über 66 %, sei rein willkürlich, ohne technische Stütze und trage als solches nicht zur Abgrenzung der Erfindung vom Stand der Technik bei. Es sei lediglich ein Ausschlusswert und stelle keine neue Lehre dar.

Wenn man Dokument D26 als nächstliegenden Stand der Technik betrachte, hätte der Fachmann in Dokument D69 ohne irgendeinen Aufwand die geeigneten Mittel zur Identifizierung eines atypischen Stamms finden können, der stark mit Seren von Patienten aus Afrika, insbesondere aus Kamerun, und schwach mit Seren von Patienten aus Deutschland reagierte.

Aus Dokument D26 hätte der Fachmann entnommen, dass aus einem bekannten HIV-1-Stamm abgeleitete Primers geeignet sind. Er hätte nach einem Stamm gesucht, der sich immunologisch wie in Dokument D15 beschrieben verhält und dieselbe reverse Transkriptase und dieselben Hüllproteine aufweist.

Ansprüche 4 bis 12

Das Patent enthalte keinerlei Aussage zu einem Antigen, das von der Aminosäuresequenz aus der Tabelle 3 - mit Ausnahme des Peptids RLQALETLIQNQQRLNLWGCKGKLICYTSVKWNTS - oder allgemeiner von einem Protein des Isolats MVP-5180/91 herleitbar sei. Im Versuchsteil der Beschreibung sei nur das gesamte gp41 getestet worden. Deshalb sei die technische Aufgabe, nämlich die Bereitstellung von Antigenen, die zum Nachweis des Isolats MVP-5180/91 nützlich seien, nicht für den gesamten Schutzumfang der Ansprüche 4 und 10 gelöst worden. Der Einwand gelte auch für die abhängigen Ansprüche 5 bis 9 und 11 bis 12. Da außerdem im Patent keine Epitope identifiziert worden seien und da auf die in den Versuchen des Patents verwendeten Seren nicht richtig Bezug genommen worden sei, trügen die Ansprüche 4 bis 12 nichts zum Stand der Technik bei.

XVIII. Das Vorbringen der Beschwerdeführerin IV, soweit es für die vorliegende Entscheidung relevant ist, lässt sich wie folgt zusammenfassen:

Nicht ausreichende Offenbarung (Art. 83 EPÜ)

Das angegriffene Patent liefere keine Definition des Begriffs "Homologie" und keine eindeutige Anleitung zu deren Berechnung. Die Homologie lasse sich unter Zugrundelegung verschiedener Parameter berechnen, wobei verschiedene Parameter zu verschiedenen Ergebnissen führten (vgl. Dokument D34). Welche Parameter heranzuziehen seien, werde nicht festgelegt. Demnach sei der Fachmann nicht in der Lage zu überprüfen, falls er ein Virusisolat in Händen halte, ob das jeweilige Isolat von dem Merkmal der 66%igen Homologie des Anspruchs 1 Gebrauch mache oder nicht.

Neuheit (Art. 54 EPÜ)

Dokument D1 stehe dem Anspruch 1 neuheitsschädlich entgegen, weil der Fachmann dessen Lehre folgend zu einem Virus gelange, das die Merkmale des Anspruchs erfülle.

Dokument 1 enthalte viel mehr technische Informationen zu dem darin beschriebenen Virus Ant-70 als lediglich die Teilsequenz des env-Gens. So werde ausführlich die Herkunft des neuen Virus aus einer Region in Afrika beschrieben, die zwischen Westafrika und Ostzentralafrika liege. Auch die Virusisolierung werde beschrieben sowie dessen ausführliche Charakterisierung. Danach beschreibe Dokument D1 zweifelsfrei einen neueren Virustyp, der weder HIV-1 noch HIV-2 zuzuordnen sei. Die Nacharbeitbarkeit der Lehre von Dokument D1 im Sinne von Artikel 83 EPÜ werde schließlich auch durch den Umstand der Patenterteilung seitens des EPA bestätigt. Demzufolge sei vor dem Prioritätstag des angegriffenen Patents ein Virus der Öffentlichkeit zugänglich gemacht worden, das unter die neue Virusgruppe, wie in Anspruch 1 beansprucht, falle. Dass das in Dokument D1 beschriebene Virus unter die in Anspruch 1 beanspruchte Gruppe falle, werde ferner auch durch den Vergleich biochemischer Parameter ersichtlich. So betone beispielweise das angegriffene Patent, dass der vermeintlich neue Virustyp, wie von MVP-5180/91 repräsentiert, eine reverse Transkriptase mit einem Molekulargewicht von 48 kD aufweise. Dies sei genau das Molekulargewicht, das auch bereits in Dokument D1 als Molekulargewicht für die reverse Transkriptase des beschriebenen Ant-70 offenbart sei. Schließlich würden in Dokument D1 bereits die immunologischen Unterschiede zwischen Ant-70 und den bereits zuvor bekannten HIV-1- bzw. HIV-2-Isolaten beschrieben. Demzufolge offenbare Dokument D1 bereits einen neuen Virustyp, der sich sowohl immunologisch wie auch biochemisch von den vorbekannten Virustypen HIV-1 und HIV-2 unterscheide, wobei die Unterschiede genau diejenigen seien, die in dem angegriffenen Patent auch für MVP-5180/91 geltend gemacht würden. Daher bedürfe es überhaupt keines Sequenzvergleichs, um die Zugehörigkeit von Ant-70 und MVP-5180/91 zur gleichen Virusgruppe eindeutig zu belegen.

Erfinderische Tätigkeit (Art. 56 EPÜ)

Es sei bereits der Fachwelt aus diesem Stand der Technik bekannt, dass es in Kamerun HI-Viren eines neuen Subtyps gebe, welche sich von HIV-1 und HIV-2 serologisch unterschieden.

Dokument D1 beschreibe, dass das neue Virus ANT-70 in Blutproben aus Kamerun identifiziert werde, wobei übliche Verfahren zur Virusisolierung eingesetzt würden. Die so erhaltenen Isolate würden dann nach immunologischen Methoden charakterisiert. Genau dieses Vorgehen aus Dokument D1 werde auch der Virusisolierung gemäß dem angegriffenen Patent zugrunde gelegt.

Auch Dokument D26 weise bereits auf das Vorkommen einer neuen HIV-Variante in Kamerun hin. Wie Dokument D1, so hebe Dokument D26 die veränderte Reaktivität eines Virusisolats aus Kamerun im Vergleich zu vorbekannten HIV-1-Stämmen wie auch das geänderte Molekulargewicht der reversen Transkriptase hervor.

Dem Fachmann sei bekannt gewesen, wie man das entsprechende Virus aus Patientenproben isolieren und charakterisieren könne. Ausgehend von Dokument D1 bzw. Dokument D26 könne der Fachmann ohne weiteres Viren des neuen Subtyps finden. Hierzu bedürfe es keiner einzigen erfinderischen Maßnahme, da sämtliche Schritte zur Virusisolierung den üblichen Maßnahmen auf diesem Gebiet entsprächen. Demzufolge sei der einzige Beitrag zum Stand der Technik durch das vorliegende Patent die weitere molekularbiologische Charakterisierung des bereits in Dokument D26 beschriebenen Virus MVP-5180/91. Dies beruhe nicht auf erfinderischer Tätigkeit.

XIX. Die Beschwerdeführerin I (Patentinhaberin) beantragte die Aufhebung der angefochtenen Entscheidung und die Aufrechterhaltung des europäischen Patents Nr. 0 591 914 auf Basis des in der mündlichen Verhandlung vom 7. Oktober 2008 eingereichten Hauptantrags.

XX. Die Beschwerdeführerinnen II, III und IV beantragten die Aufhebung der angefochtenen Entscheidung und den Widerruf des europäischen Patents Nr. 0 591 914.

Entscheidungsgründe

Zulässigkeit der Änderungen (Art. 123 (2) EPÜ) und Klarheit (Art. 84 EPÜ)

1. Gegen den in der mündlichen Verhandlung vom 7. Oktober 2008 als Hauptantrag eingereichten Anspruchssatz verblieben nur wenige Einwände formaler Art, nämlich dass Anspruch 4 von den ursprünglichen Ansprüchen der Anmeldung in der eingereichten Fassung nicht ausreichend gestützt werde (Einwand nach Art. 123 (2) EPÜ) und dass der Wortlaut dieses Anspruchs nicht ganz eindeutig sei, was das Vorliegen eines nicht-viralen Anteils betreffe (Einwand nach Art. 84 EPÜ) (s. Nr. XVII).

2. Was die Frage der Stützung des Gegenstands des Anspruchs 4 durch die Anmeldung in der eingereichten Fassung betrifft, so sind nicht nur die Ansprüche in der ursprünglich eingereichten Fassung, sondern die gesamte Anmeldung zu berücksichtigen. In Letzterer ist auf S. 7 (s. die veröffentlichte A2-Schrift) ausdrücklich angegeben, dass der Gegenstand der Erfindung die hinterlegten Viren und all die Varianten sind, die eine Nukleotidsequenz entsprechend der Tabelle 3 oder mit einer Homologie von über 66 % dazu aufweisen, und dass Antigene dieser Viren mit einer Sequenz von mindestens 6 Aminosäuren in Testkits verwendet werden können, um Antikörper gegen diese Viren nachzuweisen. Die Ansprüche 21 bis 23, die sich auf die Ansprüche 13 bis 20 zurückbeziehen, die sich wiederum auf die Ansprüche 11 bis 12 zurückbeziehen und dadurch auf die Ansprüche 1 bis 10, spiegeln diese Offenbarung wider. Nach Ansicht der Kammer ist dies insgesamt eine direkte Stütze für den Gegenstand des Anspruchs 4.

3. Was die Klarheit des Anspruchs 4 betrifft, der eine geänderte Version des Anspruchs 7 in der erteilten Fassung ist, sind die Beschwerdeführerinnen II/III der Ansicht, dass er auch einen möglichen nicht-viralen Anteil abdecken kann.

4. Abgesehen davon, dass Antigene mit einem nicht-viralen Anteil im Patent nicht genannt werden, führt der Wortlaut des Anspruchs 4 den Leser eindeutig fort von einem solchen Konzept, da es heißt, dass die Aminosäuresequenz des Antigens ganz oder teilweise der Sequenz des gesamten Peptids gemäß der Tabelle 3 oder nur einer Teilsequenz von mindestens 6 Aminosäuren entspricht. Nach Auffassung der Kammer ist dieser Wortlaut eindeutig.

5. Gegen die Ansprüche des Hauptantrags wurden von den Einsprechenden/Beschwerdeführerinnen keine weiteren formalen Einwände erhoben, sodass dieser insoweit als EPÜ-konform betrachtet werden kann.

Offenbarung der Erfindung (Art. 83 EPÜ)

Die Varianten (Ansprüche 1 bis 3)

6. Einen Großteil der Diskussion in der ersten und der zweiten mündlichen Verhandlung beanspruchte die Frage der ausreichenden Offenbarung der Varianten des hinterlegten Virus gemäß den Ansprüchen 1 bis 3. Am Ende der ersten Anhörung am 7. Oktober 2008 entschied die Kammer, das Verfahren schriftlich fortzusetzen. Sie erließ dann einen Bescheid, in dem die Auffassung vertreten wurde, dass Anspruch 1 nicht den Erfordernissen des Artikels 83 EPÜ genügt, und schloss die sachliche Debatte in dieser Hinsicht. Zu Beginn der zweiten Anhörung am 29. und 30. April 2009 beschloss die Kammer jedoch, die sachliche Debatte - gemäß Artikel 15 (5) VOBK - wieder zu eröffnen und ließ weiteres Vorbringen der Parteien zu. Dies betrachteten die Einsprechenden/Beschwerdeführerinnen als überraschend, weil es dem Bescheid der Kammer nach der ersten Anhörung widersprach. Letzterer hatte jedoch keine Bindungswirkung. Da die Kammer bei der Vorbereitung der zweiten mündlichen Verhandlung unter Berücksichtigung des gesamten von den Parteien eingereichten Vorbringens Bedenken bekommen hatte, ob ihre im Bescheid geäußerte Auffassung, dass Anspruch 1 den Erfordernissen des Artikels 83 EPÜ nicht genüge, tatsächlich zutreffend war, war es ihre Pflicht, die Debatte wieder zu eröffnen. Denn es ist vornehmste Aufgabe der Beschwerdekammern, eine Entscheidung zu treffen, die nach der aus der Würdigung des Prozessstoffes gewonnenen Überzeugung der Kammer richtig ist. Gerade für diese Fälle ist die in Artikel 15(5), Satz 2 VOBK vorgesehene Möglichkeit zur Wiedereröffnung der Debatte gedacht. Die weitere Debatte überzeugte die Kammer dann aus den nachstehenden Gründen davon, dass die Varianten des hinterlegten Virus als in der Patentschrift ausreichend offenbart betrachtet werden können.

7. Die ausreichende Offenbarung des spezifischen hinterlegten viralen Stamms ist unbestritten. Durch die Hinterlegung hat der Fachmann materiellen Zugang zu der Erfindung, die in der Patentschrift in technischen Begriffen offenbart ist. Somit kann der Fachmann leicht überprüfen, ob der betreffende Stamm die in der Beschreibung dargestellten Merkmale aufweist.

8. Die Einsprechenden/Beschwerdeführerinnen bringen vor, dass Varianten des Virus gemäß den Ansprüchen 1 bis 3 so vage beschrieben seien, dass der Fachmann nicht entscheiden könne, ob ein neu isolierter Stamm als Variante des spezifischen Isolats MVP-5180/91 betrachtet werden könne, und dass der bloße Hinweis auf das zwingende Vorhandensein der Sequenz aus der Tabelle 3 oder einer Sequenz mit einer Homologie von über 66 % dazu eine unzureichende Anleitung darstelle.

9. Zwar ist es zutreffend, dass der Begriff "Variante" an sich noch keine genauen Grenzen definiert, doch ergibt sich aus dem Begriff der Variante, dass eine Variante eines bestimmten individuellen Organismus (hier eines hinterlegten Virus, der als Standard zu verwenden ist) nur ein anderer individueller Organismus sein kann, der mit dem Standard die wesentlichen unterscheidenden Merkmale gemeinsam hat und davon nur geringfügig abweicht.

10. Im vorliegenden Fall ist der Referenzstandard der hinterlegte Stamm MVP-5180/91, zu dem die Beschreibung auf Seite 2, Zeile 52 bis Seite 6, Zeile 18 in der Patentschrift eine Reihe von Merkmalen enthält, die insgesamt als Merkmale dargestellt werden, die ihn von bekannten Stämmen unterscheiden. Dies sind: a) morphologische Merkmale, einschließlich der Fähigkeit zum Wachstum in einer Reihe von Zelllinien; b) immunologische Merkmale, einschließlich der Fähigkeit des gp41, stark mit Antikörpern aus Seren von afrikanischen Patienten zu reagieren, während die Reaktion mit Seren von deutschen Patienten schwach ist; und c) strukturelle Merkmale, unter anderem eine reverse Transkriptase mit geringerem Molekulargewicht als die reverse Transkriptase anderer am Anmeldetag bekannter HIV-1- und HIV-2-Stämme. Ein weiteres wesentliches Merkmal des Isolats MVP-5180/91 ist in Beispiel 13 (s. S. 20 der Patentschrift) genannt, das die Konfiguration des V3-Loops des Isolats MVP-5180/91 beschreibt, die inzwischen als markanteste Abweichung gegenüber anderen HIV-Typen bekannt ist (s. das als Gutachten herangezogene nachveröffentlichte Dokument D4, S. 1584, letzter Absatz in der linken Spalte).

11. Auf Seite 6 der Patentschrift heißt es in den Zeilen 19 bis 20: "Die oben angegebenen Charakteristika kennzeichnen solche Virus-Varianten, die dem erfindungsgemäßen MVP-5180/91 entsprechen". Nach Auffassung der Kammer wird der Ausdruck "Varianten des Virus" in Anspruch 1 vom Fachmann einfach als "Kurzweg" zu dieser Definition verstanden. Hätte man nämlich sämtliche Merkmale in den Anspruch aufgenommen, wäre dieser schwieriger zu lesen gewesen. Wie bereits erläutert, kann der Fachmann, der Zugang zu dem hinterlegten Standardstamm hat, ohne unzumutbaren Aufwand diese Merkmale überprüfen und somit feststellen, ob ein neu gefundenes Isolat diese Merkmale mit dem Standard gemeinsam hat. Hier ist auch zu erwähnen, dass die Patentschrift in der Fig. 4 die (nahezu) vollständige Sequenz des erfindungsgemäßen Virus offenbart. Dies sollte auch die Erkennung von Isolaten erleichtern, die geringfügig vom Standard abweichen.

12. In den Ansprüchen 1 bis 3 wird für diejenigen "Varianten des Virus" Schutz begehrt, die die Sequenz aus der Tabelle 3 enthalten oder eine Sequenz, die eine Homologie von über 66 % (s. Anspruch 1), 75 % (s. Anspruch 2) oder 85 % (s. Anspruch 3) auf der Grundlage der Nukleotidsequenz dieser Tabelle aufweist. Die Beschreibung enthält Informationen über die Computerprogramme, die für die Bestimmung der Sequenzhomologie verwendet wurden (vgl. Beispiele 8 und 10), was dem Fachmann erlauben sollte, diese Arbeitsschritte ohne unzumutbaren Aufwand durchzuführen. Die Beschwerdeführerin IV wandte hierzu ein, dass sich die Homologie unter Zugrundelegung verschiedener Parameter berechnen lasse, wobei verschiedene Parameter zu verschiedenen Ergebnissen führten und dass es nicht festgelegt sei, welche Parameter heranzuziehen seien. Nach Auffassung der Kammer verwendet der Fachmann mangels spezifischer Informationen die Standardparameter, und dies stellt für ihn keinen unzumutbaren Aufwand dar.

13. Ob die untere Grenze "Homologie von über 66 %" eine bestimmte Bedeutung hat oder willkürlich gewählt wurde, scheint für die Frage der ausreichenden Offenbarung irrelevant, da zum einen eine Isolatvariante des hinterlegten Virus ohne unzumutbaren Aufwand erkannt werden kann und zum anderen das Vorhandensein der Sequenz der Tabelle 3 oder einer Sequenz mit einer Homologie von über 66 % dazu leicht durch herkömmliche Verfahren festgestellt werden kann.

14. Deshalb ist die Kammer der Ansicht, dass angesichts des gesamten Inhalts der Beschreibung gemäß der Patentschrift der Fachmann ohne unzumutbaren Aufwand herausfinden kann, ob ein neu isolierter Stamm als Variante des spezifischen Isolats MVP-5180/91 gemäß den Ansprüchen 1 bis 3 betrachtet werden kann. Ihr Gegenstand genügt somit den Erfordernissen des Artikels 83 EPÜ.

Das Testkit (Ansprüche 4 bis 9)

15. Die Einsprechenden/Beschwerdeführerinnen behaupten, dass die Ansprüche auf das Testkit nicht nacharbeitbar sind, weil die Patentschrift keine Lehre für antigene Peptide mit der erforderlichen Aktivität enthält, d.h. die Erkennung durch Antikörper gegen HI-Viren gemäß den Ansprüchen 1 bis 3. Sie berufen sich darauf, dass das einzige infrage kommende Peptid, nämlich das Peptid aus 35 Aminosäuren (nachfolgend MVP35; vgl. S. 15, Z. 30 bis 50 der Patentschrift) nicht getestet wurde. Ihrer Ansicht nach ist außerdem die Mindestlänge von 6 Aminosäuren nicht ausführbar. Zur Stützung dieser Einwände wurden Versuchsberichte eingereicht, siehe insbesondere die Dokumente D48 und D62, und es wurde speziell hingewiesen auf die Lehre von Gnann et al., siehe Dokumente D11, D12 und D28.

16. Die Patentinhaberin/Beschwerdeführerin reichte in Erwiderung auf diesen Einwand Nachweise von Gegenversuchen ein, siehe insbesondere die Dokumente D51, D52, D58, D59, D65 und D66.

17. Die Patentschrift enthält eine vollständige Offenbarung des spezifischen Isolats MVP-5180/91, das durch die Hinterlegung auch physisch für die Öffentlichkeit zugänglich ist, sowie - wie oben gezeigt - von Varianten dazu. Die fast vollständige Sequenz des Virus ist in Fig. 4 dargestellt. Die Patentschrift betont vor allem den Abschnitt des für gp41 codierenden Genoms (vgl. Tabelle 3), das nach den Angaben in der Patentschrift immunserologische Bedeutung hat. In diesem Bereich ist ein Peptid aus 35 Aminosäuren (MPV35) hervorgehoben, das als diagnostisch besonders relevant angesehen wird. Während die Patentschrift zwar angibt, dass der Fachmann anhand der Sequenzinformation immunodominante Epitope mit einer Länge von mindestens 6 Aminosäuren herstellen kann, die für diagnostische Zwecke verwendet werden können, enthält sie keine wirklichen Daten, und die einzigen genannten immunologischen Daten beziehen sich entweder auf das gesamte Virus oder auf das gesamte gp41.

18. Hier stellt sich die Frage, ob dem Fachmann ein unzumutbarer Aufwand entsteht, wenn er im Bereich der Ansprüche arbeitet, und wer die Beweislast trägt.

19. Am maßgeblichen Anmeldetag waren Techniken zur Synthetisierung von Peptiden beliebiger Länge verfügbar. Bekannt waren auch Techniken zur Kartierung von Epitopen auf der Grundlage der Aminosäuresequenz eines Proteins und Verfahren zum Scannen von Peptiden, die auf Antikörper reagieren (vgl. z. B. Dokument D60). Die Kammer geht deshalb grundsätzlich davon aus, dass der Fachmann anhand der strukturellen Informationen aus der Patentschrift und bei Vorliegen des Virusstamms durch zeitaufwendige, aber routinemäßige Arbeit zu Peptiden gelangen könnte, die in Testkits gemäß den Ansprüchen 4 bis 9 verwendet werden können. In dieser Hinsicht liegt die Beweislast für das Gegenteil bei den Einsprechenden/Beschwerdeführerinnen.

20. So legte auch die Beschwerdeführerin III einen experimentellen Nachweis (vgl. Dokumente D48 und D62) zur Stützung ihres Einwands nach Artikel 83 EPÜ vor. Dieser Nachweis soll zwar zeigen, dass ein Peptid aus 6 Aminosäuren (insbesondere das Hexamer KGKLIC) nicht als Epitop vorgeschlagen werden kann, zeigt aber, dass Peptide mit 9, 10, 12, 15, 21 Aminosäuren (MVP9, MVP10, MVP12, MVP15, MVP21, die alle vom Peptid MVP35 abgeleitet sind) und MVP35 zur Ermittlung von Antikörpern gegen das Isolat MVP-5180/91 und Varianten davon geeignet sind. Die Peptide wurden mithilfe von ELISA-Tests wie in der Patentschrift beschrieben darauf getestet (s. S. 7, Z. 28 bis 41), ob sie mit Antikörpern reagieren, die in 47 Seren von infizierten Patienten enthalten waren (s. D48, S. 1, Nr. 1.1 und S. 4, Nr. 4.1), und wurden hierzu direkt auf dem Boden der Näpfchen einer Mikrotiterplatte gebunden.

21. Hier ist anzumerken, dass mit Ausnahme des Hexamers dieser Nachweis den Anspruch eher bestätigt als widerlegt. Um die mangelnde Eignung des Hexamers KGKLIC zu bestätigen, wurden von der Beschwerdeführerin III in Dokument D62 zusätzliche Tests durchgeführt, die zeigen, dass KGKLIC auch bei einem Test in einer flüssigen Phase, d. h. ohne Fixierung in den Näpfchen einer Mikrotiterplatte, keine Antikörper entdecken kann, die auf das Isolat MVP-5180/91 und Varianten davon gerichtet sind (s. S. 1, zweiter Absatz).

22. Die Beschwerdeführerin I legte Versuchsberichte vor (s. D51, D52, D58, D59, D65 und D66), mit denen die Immunreaktivität mit dem Anti-HIV-1 Subtyp O (zu dem der hinterlegte Stamm gehört) getestet wurde für i) das spezifische Hexamer KGKLIC oder 29 andere von MPV35 abgeleitete Hexamere oder 25 verschiedene Hexamere aus dem C-Terminus von gp120 oder ii) das Peptid AVGLGMLFLGVLSAAGSTMGAAA (N-Terminus von gp41 gemäß der Tabelle 3) oder das Peptid EMRNCSFNVTT (eine Sequenz von gp120 außerhalb der Sequenz der Tabelle 3). Es wurde gezeigt, dass das spezifische Hexamer KGKLIC unter verschiedenen Versuchsbedingungen reaktiv war und dass einige der anderen Hexamere ebenfalls reagierten. Die unter ii) genannten Peptide waren ebenfalls reaktiv.

23. In ihren Bemerkungen zu diesen Versuchen argumentierte die Beschwerdeführerin III, dass die positiven Ergebnisse, insbesondere diejenigen mit dem Hexamer KGHLIC, mit Methoden erhalten worden seien, die im Patent nicht offenbart worden seien und die nicht glaubwürdig seien, weil sie der "Lehre von Gnann et al.", die den Dokumenten D11, D12 und D28 zu entnehmen sei, widersprächen. Sie argumentierte außerdem, dass die Tests der Beschwerdeführerin I eine zu geringe Zahl von Plasmen mit dem Anti-HIV-1 Subtyp O umfassten und dass die Versuchsberichte keine Kriterien für die Entscheidung angäben, ob ein Test als positiv gelte.

24. Was die Kritik an den von der Beschwerdeführerin I verwendeten Methoden betrifft, so ist festzustellen, dass die Offenbarung im Patent keineswegs auf die Verwendung eines ELISA-Tests beschränkt ist, geschweige denn eines ELISA-Tests, bei dem das Antigen direkt auf der Platte immobilisiert wird. Dies ist eindeutig Seite 7, Zeilen 28 bis 31 der Patentschrift zu entnehmen: "Bei den diagnostischen Tests wird eine Serumprobe der zu untersuchenden Person zusammengebracht mit den Proteinketten von einem oder mehreren Proteinen oder Glykoproteinen (die in eukaryontischen Zellinien exprimiert werden können) oder Teilen davon, die von MVP-5180/91 stammen. Bevorzugte Testverfahren schließen die Immunfluoreszenz oder immunenzymatische Testverfahren (z. B. Elisa, Immunoblot) ein." (Hervorhebung durch die Kammer). Der Einwand ist deshalb nicht haltbar.

25. Hinsichtlich des anderen Kritikpunkts, dass die mit KGKLIC erhaltenen positiven Ergebnisse ungültig sind, weil sie der Lehre von Gnann et al. widersprechen, ist Folgendes anzumerken:

a) In Dokument D28 ist offenbart, dass die Aminosäuresequenz LGIWGCSGKLIC, die in der Aminosäuresequenz RILAVERYLKDQQLLGIWGCSGKLIC enthalten ist, die sich wiederum im gp41 des Prototyps des HIV-1-Stamms LAVBRU findet, ein immundominanter Bereich von HIV ist, der von Serumantikörpern von HIV-infizierten Patienten erkannt wird (s. Zusammenfassung auf S. 261 und Tabelle 2 auf S. 265).

b) In Dokument D12 ist beschrieben, dass das minimale wesentliche Epitop innerhalb der Sequenz LGLWGCSGKLIC die aus 7 Aminosäuren bestehende Sequenz CSGKLIC ist, die zwei Cysteinreste aufweist.

c) In Dokument D11 heißt es, dass das hoch immunreaktive Epitop auf dem gp41 aller HIV-ähnlichen Viren, die am Veröffentlichungstag sequenziert waren, die Aminosäuresequenz WGCXXXXXC aufweist.

26. In keinem der oben genannten Dokumente von Gnann et al. wird die Frage behandelt, ob das Peptid KGKLIC für einen Test wie hier beansprucht geeignet ist. Keines von ihnen enthält die ausdrückliche Lehre, dass ein Peptid aus 6 Aminosäuren unter keinen Umständen immunreaktiv sein kann. Unter Berücksichtigung der Bemerkungen unter Nr. 24 ist die Kammer der Ansicht, dass Dokument D65, gegen das die Beschwerdeführerin III nur einwandte, dass die verwendete Methodik (ELISA-Test, wobei das Peptid durch die Verwendung von Streptavidin auf der Platte immobilisiert wird) nicht im Patent offenbart sei (s. S. 35 des Schreibens der Beschwerdeführerin III vom 4. September 2008), ausreichend nachweist, dass KGKLIC - immobilisiert oder nicht - mit Antikörpern reagieren kann, die in Anti-HIV-1-Subtyp-O-positiven Plasmen enthalten sind. Die Dokumente D58 und D59 haben auch gezeigt, dass einige andere von MVP35 oder vom C-Terminus von gp120 abgeleitete Hexamere ebenfalls immunreaktiv sind. Andere Hexamere reagierten nicht. Jedoch würde der Fachmann nicht erwarten, dass jedes Peptid bestehend aus 6 Aminosäuren aus der Aminosäuresequenz der Tabelle 3 und insbesondere aus der Sequenz von MVP35 ein geeignetes Antigen für ein Testkit gemäß Anspruch 4 ist. Weder der Wortlaut von Anspruch 4 noch die Offenbarung der Erfindung rechtfertigen ein solches Erfordernis, damit das Testkit als ausreichend offenbart gilt. Es gehört zum allgemeinen Fachwissen, dass nicht jeder Abschnitt eines bestimmten Proteins antigenisch ist, sondern nur die Abschnitte, die ein Epitop enthalten.

27. Was andere Peptide betrifft, die unter den Schutzumfang des Anspruchs 4 fallen (s. Nrn. 21 und 22), so bestätigen das Dokument D48 der Beschwerdeführerin III und die Dokumente D58 und D59 der Beschwerdeführerin I, dass ausgewählte Peptide unterschiedlicher Länge immunreaktiv sind. Unter diesen Umständen muss die Kammer anerkennen, dass Anspruch 4 in seinem gesamten Umfang ausführbar ist. Die Beweislast lag bei den Gegenparteien, die nachprüfbare Fakten zur Stützung der Behauptung beizubringen gehabt hätten, dass das Testkit nicht über den kompletten Schutzumfang des Anspruchs ausführbar ist. Dieser Beweis wurde nicht geführt.

28. Angesichts der oben genannten Erwägungen kommt die Kammer zu dem Schluss, dass der Gegenstand des Anspruchs 4 gemäß Artikel 83 EPÜ ausreichend offenbart ist. Dieselbe Schlussfolgerung gilt für die abhängigen Ansprüche 5 bis 7 und 9. Was den Anspruch 8 angeht, so wurde der Einwand der Beschwerdeführerinnen II und III, dass ein Western Blot nicht durchgeführt werden könne, wenn das Antigen ein Hexamer sei, nicht substantiiert. Es ist auch darauf hinzuweisen, dass Anspruch 8 nicht spezifisch auf ein Hexamer als Antigen beschränkt ist. Die Kammer betrachtet deshalb auch diesen Einwand als unbegründet.

Ansprüche 10 bis 12 (Verwendungsansprüche)

29. Es wurde der Einwand erhoben, dass im Patent überhaupt nicht offenbart werde, wie ein vom Isolat MVP-5180/91 abgeleitetes Antigen zum Nachweis von Retroviren, die Immunschwäche verursachen und die den Viren gemäß Anspruch 1 angehören, zu verwenden sei.

30. Nach Auffassung der Kammer weiß ein Fachmann, der Zugang zum Isolat MVP-5180/91 und zur Beschreibung seiner Struktur und seiner immunologischen Eigenschaften hat, sehr gut, welche Schritte zur Verwendung eines davon abgeleiteten Antigens erforderlich sind, um Retroviren derselben Gruppe zu ermitteln. Dazu gehört die Herstellung von Antikörpern gegen dieses Antigen und deren herkömmliche Verwendung, um dasselbe Virus oder eine Variante davon in einer Probe nachzuweisen. Ein geeignetes Antigen kann nicht nur bevorzugt von der Aminosäuresequenz gemäß der Tabelle 3 des Patents abgeleitet werden, sondern generell von irgendeinem der viralen Proteine. Dies erfordert reine Routinetechniken. Daher erfüllt Anspruch 10 die Erfordernisse des Artikels 83 EPÜ. Dieselbe Schlussfolgerung gilt für die Ansprüche 11 und 12, die auf bevorzugte Ausführungsformen der Nutzung von Anspruch 10 gerichtet sind und die Antigene umfassen, die von der Aminosäuresequenz gemäß der Tabelle 3 abgeleitet sind.

31. Angesichts der vorstehenden Ausführungen ist zu folgern, dass der Hauptantrag insgesamt den Erfordernissen des Artikels 83 EPÜ entspricht.

Neuheit (Art. 54 EPÜ)

32. Der von den Einsprechenden/Beschwerdeführerinnen erhobene Einwand der mangelnden Neuheit gegen die Ansprüche 1 bis 3 beruht auf der Ansicht, dass Anspruch 1 zwar auf das Isolat MVP-5180/91 und Varianten davon gerichtet ist, aber alle HIV-1-Stämme des Subtyps O umfasst, einschließlich des ANT-70-Stamms, der ihrer Meinung nach im Dokument D1 offenbart wurde.

33. Die Neuheit des Isolats MVP-5180/91 an sich wird von den Parteien nicht bestritten, doch bleibt die Frage, ob vor dem Anmeldetag ein Isolat mit den wesentlichen Merkmalen von MVP-5180/91, das eine Sequenz enthält, die eine Homologie von mehr als 66 % zur Sequenz der Tabelle 3 gemäß den Ansprüchen 1 bis 3 aufweist, offenbart wurde.

34. Dokument D1 ist eine am 13. Dezember 1989, d. h. vor dem frühesten Prioritätsdatum des Patents (6. Oktober 1992), veröffentliche europäische Patentanmeldung, die als solche Teil des Stands der Technik ist und ein HIV-Isolat beschreibt. Angegeben sind die Sequenzen der Regionen LTR und 3' ORF wie auch codierende Sequenzen des env-Gens. Letztere sind auf den Seiten 9 (teilweise) und 23 dargestellt. Das Isolat wurde vor dem maßgeblichen Anmeldetag von Dokument D1 bei der ECACC unter der Eingangsnummer V88060301 hinterlegt. Eine Kopie der von dieser Einrichtung ausgestellten Bescheinigung über dessen Lebensfähigkeit wurde vorgelegt (s. Dokument D37). Aus Dokument D61 (Kopie eines Schreibens der ECACC vom 8. Oktober 2004 an den Anmelder von Dokument D1) ist bekannt, dass die ECACC keinen Bestand des Isolats mehr vorgefunden hatte und neue Proben als Ersatz anfordern musste.

35. Es lässt sich nicht beurteilen, was ein Fachmann, der am maßgeblichen Anmeldetag von Dokument D1 eine Probe des ursprünglich hinterlegten biologischen Materials erhalten hätte, aus einer daran vorgenommenen Sequenzanalyse abgeleitet hätte, da sich die Sequenz der später ersetzten und analysierten Probe von der in der Patentschrift angegebenen unterscheidet (s. Dokument D56). Die einzige zuverlässige Angabe bezüglich der Genomsequenz des Isolats ist die im Dokument D1 enthaltene Angabe. Bei den env-Sequenzen auf Seite 23 handelt es sich lediglich um Teilsequenzen (mit 243 Nukleotiden), und es ist offensichtlich nicht möglich, hieraus abzuleiten, dass sie zur Offenbarung einer Sequenz mit einer Homologie von mehr als 66 % zu der in Tabelle 3 des Streitpatents dargestellten, 1057 Basenpaare langen Nukleotidsequenz führen würden.

36. Dokument D1 ist deshalb nicht als neuheitsschädlich zu betrachten. Die Frage, ob die Hinterlegung des Isolats mit den Bestimmungen des EPÜ und des Budapester Vertrags in Einklang stand und nach wie vor steht, erscheint damit nicht entscheidungserheblich.

37. Die Ansprüche 1 bis 3 sind somit neu. Gegen die übrigen Ansprüche wurde kein Einwand wegen mangelnder Neuheit erhoben. Folglich wird befunden, dass der Hauptantrag insgesamt den Erfordernissen des Artikels 54 EPÜ entspricht.

Erfinderische Tätigkeit (Art. 56 EPÜ)

Ansprüche 1 bis 3

38. Der von den Einsprechenden/Beschwerdeführerinnen erhobene Einwand der mangelnden erfinderischen Tätigkeit bezüglich des Gegenstands der Ansprüche 1 bis 3 beruht im Wesentlichen auf der Beobachtung, dass am maßgeblichen Anmeldetag das Vorhandensein atypischer HIV-Stämme (die mit Antikörpern gegen die bekannten Stämme HIV-1 und HIV-2 nicht reagieren) in Kamerun bekannt war (vgl. Dokumente D1, D15 und D26) und dass der Fachmann im Stand der Technik, z. B. in Dokument D69, die zur Identifizierung und Isolierung eines solchen Stammes geeigneten Techniken und Mittel gefunden hätte. Ihrer Ansicht nach kann also keine erfinderische Tätigkeit in der bloßen Charakterisierung eines Isolats (MVP-5180/91) und seiner Varianten liegen, deren Existenz bekannt oder vorhersehbar war. Zur weiteren Stützung wurde auf Dokument D79 als Gutachten verwiesen, in dem die Erfinder selbst einräumten, dass die Situation des HIV-1 Subtyps O Ähnlichkeiten mit der Entdeckung von HIV-2 im Jahr 1986 aufweise und das Beispiel von HIV-2 (vgl. Dokument D69) einen einfachen Weg zur Lösung der Aufgabe nahelege.

39. Nach Auffassung der Kammer ist der nächstliegende Stand der Technik im vorliegenden Fall eines der beiden Dokumente, nämlich D15 und D26, die die vorläufige Charakterisierung des Isolats einer HIV-1-Variante offenbaren, das in Kamerun gefunden und als MVP-5180 bezeichnet wurde. Es handelt sich hier um die Zusammenfassungen zweier Präsentationen, die die damalige Erfindergruppe auf AIDS-Konferenzen gehalten hat (vgl. Nr. XV). Von den beiden Präsentationen ist nur die Zusammenfassung verfügbar. Obwohl in beiden Fällen die Bezeichnung des neu gefundenen Isolats mit der des spezifischen, im vorliegenden Fall hinterlegten Stamms identisch ist, legt nichts nahe, dass dieser Stamm vor dem Anmeldetag der vorliegenden Anmeldung öffentlich zugänglich war. Wäre dies der Fall gewesen, wäre im vorliegenden Fall ein Einwand wegen mangelnder Neuheit erhoben worden. Den Ausgangspunkt für die Bewertung der erfinderischen Tätigkeit bildet somit nur der Wortlaut der Zusammenfassungen.

40. In Dokument D15, dem späteren der beiden Dokumente, wird berichtet, dass das Isolat MVP-5180 in H9-Zellen vermehrt und durch Gradientenzentrifugation aus dem Überstand der Kultur gereinigt wurde. Danach wurden PCR-Verfahren mit unspezifizierten Primerpaaren durchgeführt, die von den Bereichen gag, pol, tat und env von HIV-Viren abgeleitet wurden. Der Stamm erwies sich als zytopathogen. Es stellte sich heraus, dass seine reverse Transkriptase anders als bei anderen am Veröffentlichungstag bekannten HIV-1- und HIV-2-Stämmen aus den Proteinen p50 und p60 anstatt p53 und p66 bestand. Die Reaktion auf die Glykoproteine gp41 und gp120 war bei "deutschen" Anti-HIV-1-Seren schwach, bei afrikanischen Seren (Kamerun, Uganda und Côte d'Ivoire) hingegen stark. Ferner wurde im PCR-Verfahren nur ein Oligonukleotid bei Verwendung der gag-Primerpaare, des pol-Gens und einer env-Bande mit unerwartetem Molekulargewicht amplifiziert. Bei den anderen Primerpaaren erhielt man keine amplifizierte DNS.

41. Aus dem früheren Dokument D26 hätte der Fachmann auch gewusst, dass der env-V3-Loop des Isolats MVP-5180 einzigartig ist, was sich darin zeigt, dass er nicht mit ausgewählten Primern amplifiziert werden konnte, die bei allen bisher untersuchten deutschen HIV-Isolaten und dem HIV-1-IIIB-Isolat funktionstüchtig waren.

42. Angesichts der oben genannten vorläufigen Charakterisierung des Isolats MVP-5180 im Stand der Technik kann die erfindungsgemäße technische Aufgabe darin gesehen werden, denselben Stamm MVP-5180 oder eine Variante davon zu isolieren, um ihn komplett zu charakterisieren und sein Genom zu sequenzieren.

43. Nach Auffassung der Kammer ist trotz der geografischen Anhaltspunkte für ein solches Virus (Kamerun, Uganda und Côte d'Ivoire) und trotz vorläufiger Merkmalsbeschreibungen in den Zusammenfassungen und des Vorliegens von Versuchsprotokollen für die Isolierung von Viren (vgl. Dokument D69) die Suche nach einem solchen Stamm wie die Suche nach "der Nadel im Heuhaufen". Unter diesen Umständen scheint es nicht angebracht, die angeblichen "Erfolgsaussichten" anzuerkennen. Insoweit ist der Bezug auf spätere Aussagen der Erfinder in Dokument D79 ungeeignet. Erst mit der Hinterlegung des spezifischen Isolats bei einer anerkannten Hinterlegungsstelle und der vollständigen Beschreibung des Stamms in der vorliegenden Patentschrift wurde es möglich, zu demselben oder einem ähnlichen Isolat zu gelangen. Dies ist das Verdienst der patentierten Erfindung, weshalb ihr eine erfinderische Tätigkeit zugesprochen werden kann.

Ansprüche 4 bis 10

44. Da das Isolat MVP-5180/91 und Varianten davon als erfinderisch betrachtet werden, gilt diese Schlussfolgerung auch für die von deren Proteinen ableitbaren Antigene sowie für Testkits, die diese enthalten (Ansprüche 4 bis 9) und für deren Verwendung zum Nachweis von Retroviren gemäß den Ansprüchen 1 bis 3 (Ansprüche 10 bis 12). Die Identifizierung des Isolats MVP-5180/91 als Quelle für solche Antigene und die Ermittlung eines diagnostisch interessanten Bereichs innerhalb der Sequenz der Tabelle 3 sind zusammengenommen ein wichtiger Beitrag zum Stand der Technik und ebnen den Weg für die weitere Identifizierung von Epitopen. Würde man zur Bejahung der erfinderischen Tätigkeit verlangen, dass jedes einzelne diagnostisch interessante Epitop identifiziert werden muss, wäre dies eine übertriebene und ungerechtfertigte Anforderung.

45. Aufgrund der vorstehenden Ausführungen lautet die Schlussfolgerung, dass der Antrag insgesamt den Erfordernissen des Artikels 56 EPÜ genügt.

Anpassung der Beschreibung

46. Im Einklang mit der einvernehmliche Meinung der Parteien erscheint der Kammer eine Anpassung der Beschreibung nicht erforderlich.

ENTSCHEIDUNGSFORMEL

Aus diesen Gründen wird entschieden:

1. Die angefochtene Entscheidung wird aufgehoben.

2. Das Verfahren wird an die erste Instanz mit der Anordnung zurückverwiesen, das Patent mit folgenden Unterlagen aufrechtzuerhalten:

Patentansprüche des in der mündlichen Verhandlung vom 7. Oktober 2008 eingereichten Hauptantrags,

Beschreibung Seiten 3 - 5, 8 - 18, 20 der Patentschrift und Seiten 2, 6, 7, 19, eingereicht in der mündlichen Verhandlung vor der Einspruchsabteilung vom 4. März 2004,

Zeichnungen, Blätter 1/18 - 18/18 der Patentschrift.

Quick Navigation