T 0197/09 (Récepteur de l'IL-13/SANOFI) of 12.6.2012

European Case Law Identifier: ECLI:EP:BA:2012:T019709.20120612
Date de la décision : 12 Juin 2012
Numéro de l'affaire : T 0197/09
Numéro de la demande : 96938273.8
Classe de la CIB : C12N 15/12
Langue de la procédure : FR
Téléchargement et informations
complémentaires :
Texte de la décision en FR (PDF, 119.585K)
Les documents concernant la procédure de recours sont disponibles dans le Registre
Informations bibliographiques disponibles en : FR
Versions : Unpublished
Titre de la demande : Polypeptide récepteur de l'IL-13
Nom du demandeur : SANOFI
Nom de l'opposant : Zenyth Operations Pty Ltd
Wyeth
Chambre : 3.3.08

Sommaire :

-
Dispositions juridiques pertinentes :
European Patent Convention Art 123(2)
Rules of procedure of the Boards of Appeal Art 12(2)
Rules of procedure of the Boards of Appeal Art 12(4)
Mot-clé : Vice de procédure non substantiel - renvoi à la première instance et remboursement de la taxe de recours (non)
Requêtes auxiliaires 1 à 6 : disclaimer incomplet - modifications inacceptables (oui)
Requête auxiliaire 7 : satisfait aux conditions de la CBE (oui)
Exergue :

-

Décisions citées :
G 0009/92
G 0001/03
T 0484/88
Décisions dans lesquelles
la présente décision est citée :
-

Exposé des faits et conclusions

I. Un recours a été formé par le titulaire du brevet (ci-après le requérant) contre la décision intermédiaire en date du 26 novembre 2008, par laquelle la division d'opposition a considéré que la requête auxiliaire 6 (revendications 1 à 37), présentée lors de la procédure orale du 4 juin 2008, pouvait servir de base au maintien du brevet européen 0 876 482. Le brevet a été délivré à partir de la demande de brevet européen 96 938 273.8, elle-même publiée sous le numéro de publication internationale WO 97/20926 avec pour titre "Polypeptide récepteur de l'IL-13", revendiquant une priorité en date du 6 décembre 1995.

II. Six autres requêtes sont mentionnées dans la décision. A l'exception de la requête auxiliaire 2 qui a été soumise lors de la procédure orale du 4 juin 2008, elles ont été remises avec la lettre du 4 avril 2008. Ces requêtes ont été refusées au motif qu'elles ne satisfaisaient pas soit aux conditions de l'article 123(2) CBE (requête principale et requêtes auxiliaires 1 et 4), soit aux conditions de l'article 123(3) CBE (requêtes auxiliaires 3 et 5), soit encore ni aux conditions de l'article 123(3) CBE ni à celles de l'article 54(3) CBE (requête auxiliaire 2).

III. Deux oppositions avaient été formées. Les motifs de l'opposition étaient des manquements aux conditions des articles 54, 56, 83 et 123(2) CBE. La revendication 1 telle que délivrée se lisait :

"1. Polypeptide purifié, comprenant une séquence d'acides aminés choisie parmi:

a) la séquence SEQ ID nº 2,

b) toute séquence dérivée de SEQ ID nº 2 et capable de se lier spécifiquement à l'IL-13 et/ou de participer à la transduction du signal spécifiquement produit par l'IL-13 au niveau de la membrane cellulaire, et/ou capable d'interagir avec le récepteur spécifique de l'IL-4 (IL-4R/gp 140) pour former un complexe capable de lier l'IL-4 et l'IL-13."

(mise en évidence - par soulignement ou par une surcharge en caractères gras - effectuée par la Chambre)

Du fait de cette rédaction utilisant la conjonction disjonctive "ou", la revendication 1 visait notamment le mode préféré de réalisation se définissant comme un polypeptide purifié comprenant "toute séquence dérivée de SEQ ID nº2 et capable de se lier spécifiquement à l'IL-13".

IV. Le mémoire de recours était accompagné de 12 jeux de revendications qualifiés de requêtes auxiliaires et numérotés de 1 à 12. La requête auxiliaire 1 est le jeu de revendications préféré, en l'absence d'un jeu de revendications qui aurait été qualifié de requête principale. En fait, la requête principale est une requête d'ordre procédural (voir section XVI ci-après). La requête auxiliaire 12 est identique à la requête auxiliaire 6, sur la base de laquelle la division d'opposition a maintenu le brevet.

V. La revendication 1 des requêtes auxiliaires 1 à 6 se lit :

"1. Polypeptide purifié, comprenant une séquence d'acides aminés choisie parmi:

a) la séquence SEQ ID nº 2,

b) toute séquence dérivée de SEQ ID nº 2 et capable de se lier spécifiquement à l'IL-13, à l'exclusion du polypeptide de séquence

1 MARPALLGELLVLLLWTATVGQVAAATEVQPPVTNLSVSV

41 ENLCTIIWTWSPPEGASPNCTLRYFSHFDDQQDKKIAPET

81 HRKEELPLDEKICLQVGSQCSANESEKPSPLVKKCISPPE

121 GDPESAVTELKCIWHNLSYMKCSWLPGRNTSPDTHYTLYY

161 WYSSLEKSRQCENIYREGQHIACSFKLTKVEPSFEHQNVQ

201 IMVKDNAGKIRPSCKIVSLTSYVKPDPPHIKHLLLKNGAL

241 LVQWKNPQNFRSRCLTYEVEVNNTQTDRHNILEVEEDKCQ

281 NSESDRNMEGTSCFQLPGVLADAVYTVRVRVKTNKLCFDD

321 NKLWSDWSEAQSIGKEQNSTFYTTMLLTIPVFVAVAVIIL

361 LFYLKRLKIIIFPPIPDPGKIFKEMFGDQNDDTLHWKKYD

401 IYEKQSKEETDSVVLIENLKKAAP."

(mise en évidence par surcharge avec des caractères gras effectuée par la Chambre)

VI. La requête auxiliaire 7 comporte 39 revendications.

La revendication 1 se lit :

"1. Polypeptide purifié, comprenant une séquence d'acides aminés choisie parmi:

a) la séquence SEQ ID nº 2,

b) toute séquence dérivée de SEQ ID nº 2 et capable de se lier spécifiquement à l'IL-13, à l'exclusion des polypeptides se liant seuls spécifiquement à l'IL-13 avec une faible affinité et ayant une séquence au moins 50% similaire à la séquence

1 MARPALLGELLVLLLWTATVGQVAAATEVQPPVTNLSVSV

41 ENLCTIIWTWSPPEGASPNCTLRYFSHFDDQQDKKIAPET

81 HRKEELPLDEKICLQVGSQCSANESEKPSPLVKKCISPPE

121 GDPESAVTELKCIWHNLSYMKCSWLPGRNTSPDTHYTLYY

161 WYSSLEKSRQCENIYREGQHIACSFKLTKVEPSFEHQNVQ

201 IMVKDNAGKIRPSCKIVSLTSYVKPDPPHIKHLLLKNGAL

241 LVQWKNPQNFRSRCLTYEVEVNNTQTDRHNILEVEEDKCQ

281 NSESDRNMEGTSCFQLPGVLADAVYTVRVRVKTNKLCFDD

321 NKLWSDWSEAQSIGKEQNSTFYTTMLLTIPVFVAVAVIIL

361 LFYLKRLKIIIFPPIPDPGKIFKEMFGDQNDDTLHWKKYD

401 IYEKQSKEETDSVVLIENLKKAAP."

(mise en évidence par surcharge avec des caractères gras effectuée par la Chambre)

Les revendications 2 à 5 sont dépendantes vis-à-vis de la revendication 1. La revendication 6 vise une séquence d'acides nucléiques isolée codant pour un polypeptide selon l'une des revendications 1 à 5. Les revendications 7 et 8 sont dépendantes vis-à-vis de la revendication 6.

La revendication 9 vise un polypeptide purifié comprenant la séquence SEQ ID NO:4.

La revendication 10 se lit :

"10. Polypeptide purifié, caractérisé en ce qu'il s'agit d'une forme soluble du polypeptide de séquence SEQ ID nº 4 s'étendant jusqu'au résidu 343 et préférentiellement jusqu'aux résidus compris entre 336 et 342."

La revendication 11 se lit :

"11. Séquence d'acides nucléiques isolée codant pour un polypeptide selon l'une quelconque des revendications 9 à 10."

La revendication 12 est dépendante vis-à-vis de la revendication 11.

La revendication 13 se lit :

"13. Séquence d'acides nucléiques selon la revendication 11, caractérisée en ce qu'elle comprend ou est constituée par l'enchaînement de nucléotides s'étendant du nucléotide nº 1 jusqu'au nucléotide 1059, et préférentiellement jusqu'aux nucléotides compris entre 1041 et 1056 sur la séquence SEQ ID nº 3."

La revendication 14 vise un vecteur contenant une séquence d'acides nucléiques selon l'une des revendications 6 à 8 et 11 à 13. La revendication 15 est dépendante vis-à-vis de la revendication 14. La revendication 16 vise une cellule hôte transfectée par un vecteur selon l'une des revendications 14 et 15. La revendication 17 est dépendante vis-à-vis de la revendication 16.

La revendication 18 vise une sonde nucléotidique hybridant spécifiquement avec une séquence selon les revendications 6 à 8, leurs séquences complémentaires ou les ARN messagers correspondants. La revendication 19 vise une sonde nucléotidique hybridant spécifiquement avec une séquence selon les revendications 11 à 13, leurs séquences complémentaires ou les ARN messagers correspondants. La revendication 20 vise l'utilisation d'une sonde hybridant spécifiquement avec une séquence selon les revendications 6 à 8 pour une détection in vitro. La revendication 21 vise l'utilisation d'une sonde selon la revendication 19 pour une détection in vitro.

La revendication 22 vise une séquence antisens capable d'inhiber la production de polypeptides selon l'une des revendications 5 et 9 à 10.

La revendication 23 vise l'utilisation d'une séquence selon l'une des revendications 6 à 8 et 11 à 13 pour la réalisation de sondes nucléotidiques de diagnostic ou de séquences antisens utilisables en thérapie génique. Les revendications 24 et 25 visent l'utilisation d'une séquence selon l'une quelconque des revendications 18 à 21, la première comme outil de diagnostic in vitro et la seconde pour la détection d'anomalies chromosomiques.

La revendication 26 vise une méthode de diagnostic in vitro comprenant la mise en contact d'une sonde nucléotidique selon les revendications 18 à 21 avec un échantillon biologique.

La revendication 27 vise l'utilisation d'une séquence selon l'une des revendications 6 à 8 et 11 à 13 pour la production d'un polypeptide recombinant. La revendication 28 vise une méthode de production d'un polypeptide recombinant récepteur de l'IL-13, mettant en oeuvre des cellules transfectées selon l'une des revendications 16 et 17.

La revendication 29 se lit :

"29. Anticorps mono ou polyclonaux, anticorps conjugués, ou leurs fragments, caractérisés en ce qu'ils sont capables de reconnaître spécifiquement un polypeptide selon l'une quelconque des revendications 1 à 5, ou anticorps conjugués, anticorps humanisés, ou fragments F(ab')2, caractérisés en ce qu'ils sont capables de reconnaître spécifiquement un polypeptide selon la revendication 9 ou 10."

La revendication 30 vise une utilisation des anticorps selon la revendication 29 pour la purification ou la détection d'un polypeptide. La revendication 31 vise un procédé de diagnostic in vitro caractérisé en ce que l'on met en contact au moins un anticorps selon la revendication 29 avec un prélèvement biologique. La revendication 32 vise un kit de diagnostic in vitro comprenant au moins un anticorps selon la revendication 29.

La revendication 33 vise une méthode pour l'identification et/ou l'isolement d'agents capables de moduler l'activité de polypeptides selon l'une des revendications 1, 9 et 10, caractérisée en ce que l'on met en contact un composé ou un mélange contenant différents composés avec des cellules exprimant à leur surface un polypeptide selon l'une des revendications 1, 9 et 10.

La revendication 34 vise une composition pharmaceutique comprenant un polypeptide selon l'une des revendications 1 à 5 ou 9 à 10. La revendication 35 est dépendante vis-à-vis de la revendication 34.

La revendication 36 vise l'utilisation d'un polypeptide selon l'une des revendications 1 à 5 pour le criblage d'agents capables de moduler l'activité de l'IL-13Rß. La revendication 37 vise l'utilisation d'un polypeptide selon l'une des revendications 9 à 10 pour le criblage d'agents capables de moduler l'activité de l'IL-13Rß. La revendication 38 vise l'utilisation d'un polypeptide selon l'une des revendications 4, 5 et 9 pour la synthèse d'un médicament à effet antagoniste de l'IL-13.

La revendication 39 se lit :

"39. Utilisation d'un polypeptide selon l'une quelconque des revendications 1 à 5 ou 9 à 10 pour la préparation d'une composition pharmaceutique utile pour la régularisation des mécanismes immunologiques et inflammatoires produits par l'IL-13."

VII. Une comparaison de la requête auxiliaire 7 avec la requête acceptée par la division d'opposition montre que :

a) Les revendications 1 à 9, 18, 20, 35, 36 et 38 de la requête auxiliaire 7 sont strictement identiques aux revendications 1 à 9, 16, 18, 33, 34 et 36 de la requête acceptée par la division d'opposition.

b) Il n'y a pas dans la requête acceptée par la division d'opposition de revendications correspondant aux revendications 10 et 13 de la requête auxiliaire 7.

c) La rédaction des revendications 11, 12, 14 à 17, 19, 21 à 28, 33, 34 et 37 de la requête auxiliaire 7 est identique à celles des revendications 10, 11, 12 à 15, 17, 19 à 26, 31 et 32 et 35 de la requête acceptée par la division d'opposition, avec des dépendances adaptées à l'introduction des nouvelles revendications 10 et 13.

d) La revendication 29 de la requête auxiliaire 7 vise non seulement les anticorps visés par la revendication 27 de la requête acceptée par la division d'opposition mais aussi des anticorps d'une autre nature. Les revendications 30 à 32 qui se réfèrent aux anticorps de la revendication 29 se différencient par conséquent des revendications correspondantes 27 à 30 de la requête acceptée par la division d'opposition.

e) La revendication 39 de la requête auxiliaire 7 et la revendication 37 de la requête acceptée par la division d'opposition visent l'utilisation d'un polypeptide pour la préparation d'une composition pharmaceutique. Leurs portées ne sont pas les mêmes. Dans la première le polypeptide est défini par référence à des revendications précédentes alors que dans la seconde il est défini par référence directe aux identificateurs de séquence SEQ ID NO:2 et SEQ ID NO:4.

VIII. Aucun des deux opposants n'a formé un recours. Ces parties sont respectivement l'intimée I (opposant 01) et l'intimée II (opposant 02).

IX. Seule l'intimée I a répondu au mémoire de recours, en se bornant à demander la tenue d'une procédure orale si la Chambre manifestait son intention de maintenir le brevet sous la forme d'une requête autre que la requête auxiliaire 12.

X. Dans une notification en date du 19 décembre 2011, jointe en annexe à la citation à une procédure orale fixée au 12 juin 2012 et émise en application des dispositions de l'article 15(1) du Règlement de Procédure des Chambres de Recours (RPCR), la Chambre a indiqué qu'elle était de l'opinion provisoire que la procédure d'opposition était entachée d'un vice de procédure non substantiel. Elle a notamment exprimé un avis négatif au regard du respect des conditions de l'article 123(2) CBE en ce qui concerne le disclaimer de la revendication 1 des requêtes auxiliaires 1 à 6 (voir points 18 à 22 de la notification) et présenté des observations en ce que concerne le disclaimer de la revendication 1 des requêtes auxiliaires 7 à 11 (voir point 29 de la notification).

XI. Avec des lettres en date du 25 janvier 2012, du 15 février 2012 et du 30 mars 2012, l'intimée I, l'intimée II puis le requérant ont informé la Chambre de leur intention de ne pas participer à la procédure orale.

XII. La procédure orale a été tenue, comme prévu, le 12 juin 2012. Les parties n'y ont pas participé.

XIII. Les documents suivants sont cités dans la présente décision :

D1 Demande de brevet WO 97/15663 (publiée le 1er mai 1997 et revendiquant les dates de priorité des 23 octobre 1995, 22 décembre 1995 et 9 septembre 1996)

D2 Demande de brevet australien PN6135 déposée le 23 octobre 1995

D3 D. Caput et al., The Journal of Biological Chemistry, Vol. 271, No. 28, 12 July 1996, pages 16921 à 16926.

XIV. Les arguments présentés par la requérante peuvent être résumés de la façon suivante :

Aspects procéduraux

Lors de la procédure orale tenue le 4 juin 2008, le requérant avait soumis trois requêtes auxiliaires 2 modifiées. Cependant, la décision ne fait référence qu'à la seule requête auxiliaire 2 telle que remise avec la lettre du 4 avril 2008 et en motive le rejet. Une copie de cette requête est annexée à la décision.

D'après la règle 111(2) CBE et conformément à la jurisprudence des chambres de recours (voir en particulier la décision T 484/88 du 1er février 1989), chaque requête rejetée doit faire l'objet d'une décision motivée.

Etant donné que la décision n'expose pas les motifs pour lesquelles les requêtes auxiliaires 2 modifiées ont été rejetées, la procédure conduite par la division d'opposition est entachée d'un vice substantiel de procédure. Il s'ensuit que la décision doit être déclarée nulle et sans effet juridique, et la taxe de recours remboursée.

Aspects substantiels

Requêtes auxiliaires 1 à 6 (examen du disclaimer de la revendication 1)

La division d'opposition a considéré de façon erronée que la revendication 1 de la requête principale qui est également la revendication 1 de la présente requête auxiliaire 1 ne remplirait pas les conditions de l'article 123(2) CBE car le disclaimer qu'elle contient ne serait pas suffisant pour exclure la totalité de l'enseignement pertinent du document D1.

Contrairement à l'avis de la division d'opposition, le document D2, une demande de brevet australien qui est le document de priorité le plus ancien de la demande de brevet WO 97/15663 (document D1), ne fait pas partie de l'état de la technique à prendre en considération pour l'examen de la nouveauté au titre de l'article 54(3) CBE.

Seul l'enseignement du document D1, dans la mesure où il est contenu dans le document D2, fait partie de cet état de la technique.

Le document D1 décrit un polypeptide IL-13Ralpha murin de séquence SEQ ID NO:2 de 426 acides aminés comportant deux acides aminés indéterminés en positions 21 et 194. Il décrit également des séquences 50% similaires à cette séquence. Mais ces séquences ne bénéficient pas de la priorité conférée par le document D2 qui, en effet, ne décrit qu'un polypeptide IL-13Ralpha murin ayant une séquence de 424 acides aminés, ou ayant une séquence ayant au moins 50% de similarité. En revanche, la séquence de 426 acides aminés (SEQ ID NO:2) du document D1 n'est pas présente dans le document D2.

Par ailleurs, la figure 1 du document D1 décrit le polypeptide de 424 acides aminés du document D2.

La division d'opposition a considéré de façon erronée que l'homme du métier, à la lecture du document D1, aurait compris que la séquence SEQ ID NO:2 dans le corps du document D1 se réfère non pas à la séquence de 426 acides aminés de son listage de séquences mais bien à la séquence de 424 acides aminés représentée à sa figure 1.

En réalité, à la lecture du document D1, l'homme du métier aurait compris que la séquence correcte de l'IL-13Ralpha murin est la séquence SEQ ID NO:2 de 426 acides aminés qui est représentée dans son listage de séquences.

Seul le polypeptide IL-13Ralpha murin représenté sur la figure 1 du document D1 est donc opposable pour l'examen de la nouveauté au titre de l'article 54(3) CBE. Ce polypeptide est précisément exclu par le disclaimer de la revendication 1.

Requête auxiliaire 7

Dans son mémoire de recours, le requérant n'a pas fait de commentaires au regard des dispositions de la CBE quant à la requête auxiliaire 7. Néanmoins, il a pris position en ce qui concerne certaines revendications de la requête auxiliaire 2 annexée à la décision contestée que l'on retrouve à l'identique (même rédaction, mêmes références à d'autres revendications) dans la requête auxiliaire 7. Ces commentaires sont résumés ci-après.

La revendication 10 ne définit aucune plage de valeurs. Elle ne vise donc pas une invention de sélection. Ni le document D1 ni le document D3 ne décrivent un quelconque exemple spécifique de forme soluble de l'IL-13Ralpha humain.

Etant donné que le polypeptide selon la revendication 10 est nouveau, les revendications 11, 13 à 17, 22, 23, 27, 28, 33, 34 et 37 qui se réfèrent ou qui dépendent de la revendication 10, satisfont aussi au critère de nouveauté.

Les anticorps dirigés contre le polypeptide de séquence SEQ ID NO:4 selon la revendication 29 sont des anticorps conjugués, des anticorps humanisés ou des fragments F(ab')2. De tels anticorps ne sont pas décrits dans le document D1.

Les anticorps visés par la revendication 29 étant nouveaux, il s'en suit que leur utilisation visée par la revendication 30, un procédé de diagnostic selon la revendication 31 caractérisé en ce que l'on met en contact un tel anticorps avec un prélèvement biologique, et un kit selon la revendication 32 contenant au moins un tel anticorps sont également nouveaux.

La protection conférée par la revendication 30 telle que délivrée s'étendait à n'importe quel anticorps monoclonal et polyclonal et n'importe quel fragment de tels anticorps capable de reconnaître un polypeptide selon l'une ou l'autre des revendications 9 à 11 telles que délivrées, c'est-à-dire des revendications 9 et 10 de la requête auxiliaire 7. La portée de la revendication 30 telle que délivrée était donc telle que les anticorps humanisés et les fragments F (ab')2 étaient protégés. La revendication 29 de la requête auxiliaire 7 qui est dérivée de la revendication 30 telle que délivrée satisfait donc aux conditions de l'article 123(3) CBE.

L'ajout à la revendication 34 telle que délivrée, elle-même se référant à la revendication 9 telle que délivrée, d'une référence à la revendication 11 telle que délivrée, c'est-à-dire la revendication 10 de la requête auxiliaire 7, n'a pas étendu la protection qu'elle conférait puisque la revendication 11 telle que délivrée dépendait de la revendication 9 telle que délivrée. La revendication 33 de la requête auxiliaire 7 qui est dérivée de la revendication 34 telle que délivrée satisfait donc aux conditions de l'article 123(3) CBE.

XV. Les intimées n'ont fait aucun commentaire au cours de la procédure de recours.

XVI. La requérante (titulaire du brevet) demande au principal l'annulation de la décision objet du recours et le renvoi à la première instance du dossier en l'état en raison d'un vice substantiel de procédure auquel elle associe une demande de remboursement de la taxe de recours, ou à défaut le maintien du brevet sous une forme modifiée sur la base de l'une des requêtes auxiliaires 1 à 11 remises avec la lettre du 3 avril 2009.

XVII. L'intimée I (opposant 01) n'a formulé qu'une requête conditionnelle en tenue d'une procédure orale (voir section IX ci-dessus).

XVIII. L'intimée II (opposant 02) n'a formulé aucune requête.

Motifs de la décision

Aspects procéduraux

Requête en renvoi du dossier à la première instance en raison d'un vice de procédure substantiel et requête en remboursement de la taxe de recours

1. Le requérant soutient que la décision ne se réfèrerait qu'à la seule requête auxiliaire 2 déposée le 4 avril 2008 alors qu'il s'attendait, dit-il conformément à la jurisprudence des Chambres de recours, à ce que la décision comporte une motivation justifiant du rejet de chacune des trois versions modifiées de ladite requête qui ont été soumises lors de la procédure orale du 4 juin 2008.

2. La Chambre examine ci-dessous le procès-verbal de la procédure orale du 4 juin 2008 pour déterminer, en suivant son déroulement, quelles requêtes ont été soumises successivement.

3. La division d'opposition ayant considéré que la requête principale et les requêtes auxiliaires 1, 2 et 4 (remises avec la lettre du 4 avril 2008) devaient être refusées car, du fait de la revendication 1, il y avait une extension de l'objet du brevet au-delà du contenu de la demande telle qu'elle a été déposée (article 123(2) CBE), le titulaire a remplacé la requête auxiliaire 2 initiale du 4 avril 2008 par une requête modifiée. La modification apportée concernait sa revendication 1 (voir le point 5 de la décision à partir du dernier paragraphe de la page 2). Cette première requête auxiliaire 2 modifiée (dont seules les revendications 1 à 7 [en une page numérotée 48] ont été présentées à la procédure orale; voir "Annexe 1" du procès-verbal) a fait l'objet d'autres commentaires aux quatre premiers paragraphes du point 6 à la page 3 du procès-verbal.

4. La division d'opposition ayant indiqué que cette première requête auxiliaire 2 modifiée ne satisfaisait pas aux conditions de l'article 123(3) CBE, au vu de ses revendications 29 et 33, le titulaire a substitué (voir le cinquième paragraphe du point 6 à la page 3 du procès-verbal) à cette requête une deuxième requête auxiliaire 2 modifiée. Cette requête différait de celle qu'elle a remplacée par ses revendications 29 et 33 (seules les revendications 26 à 37 [contenues en deux pages numérotées 51 et 52] ont été présentées à la procédure orale; voir "Annexe 2" du procès-verbal).

5. La division d'opposition ayant considéré que la revendication 29 de cette deuxième requête auxiliaire 2 modifiée contrevenait aux dispositions de l'article 123(3) CBE, le titulaire a substitué (voir le septième paragraphe du point 6 à la page 3 du procès-verbal) à cette requête une troisième requête auxiliaire 2 modifiée. Cette requête différait de celle qu'elle a remplacée par sa revendication 29 (seules les revendications 26 à 31 [contenues en une page numérotée 51] ont été présentées à la procédure orale ; voir l'annexe 3 du procès-verbal).

6. La division d'opposition ayant considéré que cette troisième requête auxiliaire 2 modifiée, du fait des revendications 10, 11, 13 et 29, ne satisfaisait pas aux conditions de l'article 54(3) CBE (voir le deuxième paragraphe de la page 5 du procès-verbal), le titulaire a réagi en soumettant la requête auxiliaire 6.

7. Il ressort de cette analyse que la requête auxiliaire 2 initiale, après avoir été examinée et refusée, a été remplacée par une première version modifiée qui elle-même, après avoir été examinée et refusée, a été remplacée par une seconde version modifiée qui elle-même, après avoir été examinée et refusée, a été remplacée par une troisième et dernière version modifiée qui, ayant été examinée et refusée, est la seule "requête auxiliaire 2" restée dans la procédure, la version initiale, puis les première et deuxième versions modifiées, du fait des substitutions successives, ayant été abandonnées.

8. La décision écrite de la division d'opposition ne devait concerner que les seules requêtes en vigueur à la fin de la procédure orale, c'est-à-dire outre la requête principale et les requêtes auxiliaires 1, et 3 à 6, la troisième version modifiée de la requête auxiliaire 2. Il n'y avait pas lieu de donner les raisons du refus, ni de la version initiale ni des première et deuxième versions modifiées. La Chambre note que la décision T 484/88 (voir ci-dessus) citée par le requérant n'indique en aucune manière qu'une décision écrite consécutivement à une procédure orale, tenue devant une division d'opposition et au cours de laquelle une requête aurait été abandonnée, devrait expliquer les raisons pour lesquelles cette requête aurait été refusée. En fait, dans ladite décision, la Chambre a constaté que la division d'opposition, de manière erronée, n'avait pas motivé le refus de la requête principale alors même que le titulaire du brevet ne l'avait pas abandonnée. L'argument du requérant fondé sur la décision T 484/88 n'est donc pas pertinent.

9. La Chambre constate qu'en fait la décision prend position au sujet de sept requêtes dont une "requête auxiliaire 2". Il apparaît qu'en raison des caractéristiques des revendications 1 et 33 telles que citées aux points 1.2 de la page 9 et 2.3 de la page 12 de la décision, il s'agit de la première version modifiée. La Chambre constate également que, par contre, la requête auxiliaire 2 annexée à la décision est sa version initiale (voir "Annex 3").

10. En ignorant dans sa décision la troisième version modifiée de la requête auxiliaire 2, la division d'opposition a donc commis une erreur et la décision est entachée d'un vice de procédure. Néanmoins, étant observé que les première et troisième requêtes auxiliaires 2 ne diffèrent que par leurs revendications 29 et 33, il apparaît que le motif de rejet pour défaut de nouveauté d'au moins les revendications 10, 11 et 13 de la première requête auxiliaire vaut pareillement pour les revendications 10, 11 et 13 de la troisième requête auxiliaire (d'après le procès-verbal, la division d'opposition avait estimé que ces trois revendications de cette requête n'étaient pas nouvelles). La décision indique donc une raison pour laquelle la division d'opposition a considéré que la troisième version modifiée de requête auxiliaire 2 devait être rejetée, ce qui est suffisant d'un point de vue procédural. Le vice de procédure constaté ci-dessus n'est donc pas substantiel. Le renvoi pur et simple du dossier à la première instance demandé par le requérant, sans que la Chambre ne se prononce sur le fond, n'est de ce fait pas justifié, ni bien entendu, son corollaire, le remboursement de la taxe de recours.

Interdiction de la reformatio in peius

11. Conformément à la décision G 9/92 (OJ EPO 1994, 875) qui en général interdit la reformatio in peius, le titulaire du brevet étant l'unique requérant contre la décision intermédiaire maintenant le brevet dans sa forme modifiée, la Chambre de recours ne peut contester le jeu de revendications tel qu'approuvé dans ladite décision intermédiaire, c'est-à-dire la présente requête auxiliaire 12 (voir section IV ci-dessus). La question s'est posée de savoir si cette interdiction s'impose aussi pour des revendications retrouvées à l'identique dans les requêtes auxiliaires 7 à 11. Dans sa notification en date du 19 décembre 2011, la Chambre a fait des observations générales quant à de possibles manques de clarté (cf. article 84 EPC) et de support dans la demande de brevet telle que déposée (cf. article 123(2) CBE) du disclaimer de la revendication 1 des requêtes auxiliaires 7 à 11. Les intimées n'ayant pas réagi à cette prise de position provisoire et non contraignante, la Chambre considère, à la lumière de la décision G 9/92 (voir ci-dessus), qu'il n'est pas pertinent dans le cas d'espèce de former d'objections en ligne avec les observations formulées audit point 29 de sa notification.

Admissibilité des requêtes remises avec le mémoire de recours

12. L'admissibilité des requêtes auxiliaires 2 à 11, remises avec le mémoire de recours, est sujette à l'observation des conditions définies aux paragraphes 2 et 4 de l'article 12 RPCR. Cela a été rappelé au point 30 de la notification annexée à la citation par la Chambre à la procédure orale.

13. Le mémoire de recours n'expose pas expressément les rasions pour lesquelles le requérant a jugé nécessaire de soumettre onze requêtes. Cependant, compte tenu de la confusion créée par la division d'opposition en ce qui concerne ses commentaires et ses conclusions relativement à la requête auxiliaire 2 et le vice de procédure qui s'en est suivi, la Chambre admet que le requérant a pu être décontenancé et, par prudence plus que par conviction, a soumis un ensemble de requêtes tendant à couvrir les combinaisons les plus probables pour les caractéristiques discutées dans la décision. Par conséquent, usant du pouvoir discrétionnaire que lui confère l'article 12(4) RPCR, la Chambre admet dans la procédure les requêtes auxiliaires 1 à 11.

Aspects substantiels

Requête auxiliaire 1 (Article 123(2) CBE - revendication 1 - disclaimer)

14. La requête auxiliaire 1 est la requête préférée du requérant. Elle correspond mot pour mot à la requête principale prise en considération par la division d'opposition dans la décision objet du recours. La revendication 1 contient un disclaimer (voir section V ci-dessus).

15. La division d'opposition a considéré que ce disclaimer n'était pas acceptable car son introduction dans la revendication l telle que délivrée y aurait apporté une modification étendant l'objet du brevet au-delà du contenu de la demande telle qu'elle a été déposée, en violation de l'article 123(2) CBE.

16. L'introduction d'un disclaimer dans la revendication 1 telle que délivrée visait à rétablir la nouveauté en délimitant son mode de réalisation constitué par un polypeptide purifié comprenant "toute séquence dérivée de SEQ ID nº2 et capable de se lier spécifiquement à l'IL-13" (voir section III ci-dessus), par rapport au contenu du document D1.

17. Le document D1 est une demande de brevet euro-PCT qui est comprise dans l'état de la technique au sens de l'article 54(3) CBE 1973 en conjonction avec l'article 158 CBE 1973.

18. Le document D1 décrit principalement un polypeptide d'origine murine désigné par le terme "NR4" et repéré à l'aide de l'identificateur de séquence "SEQ ID NO:2". Un examen attentif des exemples indique qu'il s'agit non pas du polypeptide de 426 acides aminés représenté (avec le même identificateur de séquence) aux pages 50 à 52 du listage de séquences mais bien du polypeptide long de 424 acides aminés représenté à la figure 1. La phrase "The NR4 cDNA is predicted to encode for a protein of 424 amino acid residues" à l'exemple 6 (voir page 37, lignes 11 et 12) et la référence à la figure 1 qui est faite aux exemples 2, 3 et 6 sont significatives à cet égard. Le commentaire relatif à cette figure à la page 31, lignes 13 et 14, qui se lit "Figure 1 is a representation of the nucleotide [SEQ ID NO:1] and predicted amino acid [SEQ ID NO:2] sequence of murine NR4") achève de lèver toute équivoque.

19. Le document D1 ne se limite pas à décrire ce polypeptide NR4 de 424 acides aminés mais s'étend aux polypeptides qui ont au moins 50% de similarité avec lui en tout ou partie et ont en commun la capacité de se lier à l'IL-13 avec au moins une faible affinité (voir en particulier page 6, lignes 5 à 12 and 15).

20. Le document D2 est une demande de brevet australien déposée le 23 octobre 1995, soit antérieurement à la date de priorité du brevet contesté (le 6 décembre 1995). D2 est le document de priorité le plus ancien du document D1. Il décrit précisément un ensemble de polypeptides capables de se lier à l'IL-13 comprenant un polypeptide de séquence SEQ ID NO:2 représentée dans le listage de séquences (voir pages 23 et 24) qui est celui de la figure 1 du document D1, également capable de se lier à l'IL-13 avec une faible affinité, et tout polypeptide ayant au moins environ 50% de similarité avec ledit polypeptide ou avec une quelconque partie de celui-ci (voir page 3, lignes 30 et 31, page 4, lignes 6 à 8, et page 6, lignes 2 à 4).

21. Les polypeptides, pour autant qu'ils sont capables de se lier à l'IL-13 avec une faible affinité, pareillement décrits dans le document D1 et ledit document de priorité D2, sont couverts par la revendication 1 telle que délivrée. S'agissant d'une divulgation accidentelle (car le document D1 n'était pas accessible au public à la date de dépôt du brevet en question), le requérant est en droit de les exclure de la revendication 1 au moyen d'un disclaimer (voir le point 2.1 du dispositif de la décision G 1/03 - JO OEB 2004, 413).

22. Pour une revendication donnée, ne peut être autorisé qu'un disclaimer qui exclut toute la partie de l'objet revendiqué qui a été accidentellement divulguée. Or précisément, le disclaimer de la revendication 1 omet d'exclure les polypeptides dont la séquence a au moins 50% de similarité avec la séquence de 424 acides aminés de la figure 1 du document D1 ou avec une quelconque partie de cette séquence et qui sont capables de se lier avec l'IL-13 avec une faible affinité. Il n'est donc pas acceptable au sens de l'article 123(2) CBE.

23. L'argument du requérant, selon lequel l'homme du métier aurait compris que la séquence correcte de l'IL-13Ralpha murin est la séquence de 426 acides aminés représentée avec l'indicateur de séquence SEQ ID NO:2 dans le listage de séquence du document D1 mais absente du document D2 et qu'en conséquence il aurait ignoré la séquence de 424 acides aminés, désignée par le même indicateur de séquence, ne résiste pas à l'analyse. La Chambre constate que ledit polypeptide de 424 acides aminés est décrit dans le document D1 et que cette description s'étend à tout polypeptide ayant au moins environ 50% de similarité avec ledit polypeptide ou avec une quelconque partie de celui-ci et capable de se lier à l'IL-13 avec une faible affinité (voir point 19 ci-dessus). Il y a là un ensemble de polypeptides dont chacun représente, au sens de la définition donnée au paragraphe [0022] du brevet (voir page 4, lignes 38 à 45), et en l'absence d'une définition du terme "variant" dans le brevet, un polypeptide dérivé variant du polypeptide de la séquence SEQ ID NO:2 du listage de séquences du brevet. Pour rétablir la nouveauté de la revendication 1 telle que délivrée, il y avait donc bien lieu d'exclure cet ensemble de polypeptides.

24. De l'analyse ci-dessus, il se déduit que, parce qu'il n'exclut pas cet ensemble de polypeptides dans son entièreté, le disclaimer de la revendication 1 est incomplet et ne permet donc pas de rétablir la nouveauté par rapport au document D1. Par conséquent la modification apportée par son introduction est inacceptable au sens de l'article 123(2) CBE, conformément la décision G 1/03 (voir ci-dessus). Au moins pour cette raison, la requête auxiliaire 1 doit être refusée.

Requêtes auxiliaires 2 à 6 (Article 123(2) CBE - revendication 1 - disclaimer)

25. La revendication 1 de chacune des requêtes auxiliaires 2 à 6 est strictement identique à celle de la revendication 1 de la requête auxiliaire 1 et contient notamment le même disclaimer.

26. La conclusion exprimée au point 24 ci-dessus vaut donc également pour chacune de ces requêtes. Il s'en suit que les requêtes auxiliaires 2 à 6, parce qu'elles contreviennent aux dispositions de l'article 123(2) CBE, doivent être refusées.

Requête auxiliaire 7

27. La Chambre prend acte du fait que les intimées se sont abstenues de tout commentaire, nonobstant l'invitation qui leur avait été faite de répondre au mémoire de recours et l'opportunité qu'ils ont eue de répondre à la notification de la Chambre en date du 19 décembre 2011 (voir sections IX à XI ci-dessus).

Revendications 1 à 9, 18, 20, 35, 36 et 38

28. Les revendications 1 à 9, 18, 20, 35, 36 et 38 sont strictement identiques aux revendications 1 à 9, 16, 18, 33, 34 et 36 de la requête auxiliaire 12 qui est identique à la requête acceptée par la division d'opposition (voir sections IV et VII(a), supra).

29. La Chambre, ne voyant aucune raison d'ordre procédural qui justifierait qu'elle mette en doute les conclusions de la division d'opposition à cet égard, considère par conséquent que les revendications 1 à 9, 18, 20, 35, 36 et 38 de la requête auxiliaire 7 satisfont aux conditions de la CBE (voir point 11 ci-dessus).

Revendications 10 et 13

30. Les revendications 10 et 13 n'ont pas d'équivalents parmi les revendications de la requête auxiliaire 12 (voir section VII(b) ci-dessus). Elles visent, la première, des formes solubles du polypeptide de séquence SEQ ID NO:4 (c'est-à-dire la chaîne alpha du récepteur humain de l'interleukine IL-13) et, la seconde, des séquences d'acide nucléique codant pour ces formes solubles (voir section VI ci-dessus).

31. La revendication 10 correspond à la revendication 11 telle que délivrée. Les deux revendications confèrent la même protection. Il en va de même pour la revendication 13 qui correspond à la revendication 14 telle que délivrée. Ni la revendication 11 ni la revendication 14, telles que délivrées, n'ont donné lieu, de la part des intimées lors de la procédure d'opposition, à une objection visant la présence de matière ajoutée. Les revendications 10 et 13 de la requête auxiliaire 7 remplissent par conséquent les conditions des articles 123(2) et 123(3) CBE.

32. En l'absence d'un quelconque commentaire formulé par les intimées concernant la suffisance de description relativement à leur objet, la Chambre est satisfaite que les revendications 10 et 13 remplissent également les conditions de l'article 83 CBE.

33. Les revendications 10 et 13 ne peuvent pas bénéficier de la date de priorité (6 décembre 1995) car le document de priorité ne décrit ni le polypeptide de séquence SEQ ID NO:4 ni aucune forme soluble du même polypeptide ni une séquence d'acide nucléique codant pour une telle forme soluble. Une revendication identique à la revendication 10 a été examinée par la division d'opposition qui avait conclu à un manque de nouveauté (voir point 4 de la décision attaquée). Les documents D1 et D3 ont été opposés à la revendication 10. Le document D1, cité au titre de l'article 54(3) CBE, est à considérer en tant que tel puisque sa date de dépôt international (23 octobre 1996) est antérieure à la date de dépôt international du brevet (7 novembre 1996). A ses pages 7 (ligne 7), 9 (ligne 18), 27 (lignes 21 à 23) et 30 (ligne 16), le document D1 mentionne une forme soluble de NR4 (la chaîne alpha du récepteur de l'IL-13) sans jamais distinguer entre le NR4 humain et le NR4 murin et sans une quelconque indication concernant sa structure. A partir des pages 32 et 33 (voir les commentaires relatifs aux figures 8 et 9 qui se rapportent aux exemples) du document, les seules références à une forme soluble de NR4 concernent le NR4 murin, le seul NR4 qui ait fait l'objet des expériences rapportées dans les exemples. Le document D1 ne décrit pas de manière spécifique des formes solubles de la chaîne alpha du récepteur humain de l'IL-13 ni une quelconque séquence d'acide nucléique codant pour de telles formes solubles. Le document D3 n'est pas non plus pertinent puisqu'il ne concerne que la chaîne beta. La Chambre conclut que l'objet des revendications 10 et 13 est nouveau. Les revendications 10 et 13 remplissent donc les conditions de l'article 54 CBE.

34. La revendication 10 vise des polypeptides qui sont des formes solubles du polypeptide de séquence SEQ ID NO:4 dont la mise à disposition de l'homme du métier permet de disposer, d'une manière non-évidente au vu de l'art antérieur, d'un principe actif pour notamment un médicament destiné à moduler les réactions influencées par l'IL-3 dans des situations pathologiques ou d'un composé utile pour le criblage d'agents capables de moduler l'activité de l'IL-13Ralpha. La revendication 13 donne un moyen utile pour la production desdites formes solubles par une cellule-hôte. Il est conclu que de tels polypeptides et séquences d'acide nucléique impliquent une activité inventive. Les revendications 10 et 13 de la requête auxiliaire 7 remplissent par conséquent les conditions de l'article 56 CBE.

35. La Chambre conclut que les revendications 10 et 13 de la requête auxiliaire 7 satisfont aux conditions de la CBE.

Revendications 11, 12, 14 à 17, 19, 21 à 28, 33, 34 et 37

36. La rédaction des revendications 11, 12, 14 à 17, 19, 21 à 28, 33, 34 et 37 de la requête auxiliaire 7 est identique à celles des revendications 10, 11, 12 à 15, 17, 19 à 26, 31 et 32 et 35 de la requête acceptée par la division d'opposition, avec des dépendances adaptées à l'introduction des nouvelles revendications 10 et 13 (voir section VII(c) ci-dessus).

37. Un examen comparatif permet de constater que les revendications 11, 12, 14 à 17, 19, 21 à 28, 34 et 37 de la requête auxiliaire 7 confère une protection qui n'est pas plus étendue que celle conférée par les revendications 12, 13, 15 à 18, 20, 22 à 29, 35 et 38 telles que délivrées. Il est conclu que les revendications 11, 12, 14 à 17, 19, 21 à 28, 34 et 37 de la requête auxiliaire 7 satisfont les conditions de l'article 123(3) CBE.

38. Dans la décision attaquée, en son point 2.3, il avait été considéré que la revendication 33 de la première requête auxiliaire 2 modifiée qui correspond très exactement à la revendication 33 de la requête auxiliaire 7 enfreignait les dispositions de l'article 123(3) CBE. La Chambre avait repris cette objection au point 28 de sa notification en date du 19 décembre 2011. Un réexamen du dossier l'a conduit à revoir sa position. La revendication 34 telle que délivrée, dont est issue la présente revendication 33, vise notamment, du fait de sa référence à la revendication 9 telle que délivrée, une méthode pour l'identification et/ou l'isolement d'agents capables de moduler l'activité de toute séquence dérivée de SEQ ID NO:4 et capable de se lier spécifiquement à l'IL-13. Il ne fait aucun doute que cette expression ainsi mise en évidence englobe toute forme soluble du polypeptide de séquence SEQ ID NO:4. La présente revendication 33 qui, par sa référence à la revendication 10, couvre notamment une méthode pour l'identification et/ou l'isolement d'agents capables de moduler l'activité d'une forme soluble donnée (s'étendant jusqu'au résidu 343) dudit polypeptide confère en réalité une protection restreinte par rapport à celle que confère la revendication 34 telle que délivrée. L'objection qui avait été formulée par la division d'opposition à l'encontre de la revendication 33 de la première requête auxiliaire 2 modifiée n'était donc pas fondée. Il est conclu que la revendication 33 de la requête auxiliaire 7 satisfait les conditions de l'article 123(3) CBE.

39. En l'absence de commentaires de la part des intimées et compte tenu de sa conclusion exprimée à la fin du point 11 (voir ci-dessus), la Chambre considère que, pour autant qu'elles ne se référent pas à l'une et/ou l'autre des revendications 10 et 13 et parce qu'elles correspondent alors aux revendications 10, 11, 12 à 15, 17, 19 à 26, 31, 32 et 35 de la requête acceptée par la division d'opposition, les revendications 11, 12, 14 à 17, 19, 21 à 28, 33, 34 et 37 de la requête auxiliaire 7, satisfont les conditions de la CBE et ne voit aucune raison de s'écarter de cette conclusion lorsqu'elle prend en compte ces revendications dans toute leur portée. Il est donc conclu que les revendications 11, 12, 14 à 17, 19, 21 à 28, 33, 34 et 37 de la requête auxiliaire 7 remplissent également les conditions des articles 123(2), 84, 83, 54 et 56 CBE.

40. La Chambre conclut que les revendications 11, 12, 14 à 17, 19, 21 à 28, 33, 34 et 37 de la requête auxiliaire 7 satisfont les conditions de la CBE.

Revendications 29 à 32

41. La revendication 29 vise, non seulement et de la même manière que la revendication 27 de la requête auxiliaire acceptée par la division d'opposition, des anticorps capables de reconnaître spécifiquement un polypeptide selon l'une des revendications 1 à 5, mais aussi des anticorps capables de reconnaître spécifiquement un polypeptide selon l'une des revendications 9 et 10. Ces derniers anticorps sont des anticorps conjugués, des anticorps humanisés ou des fragments F(ab')2.

42. Etant considéré qu'il n'y a pas de raison d'ordre procédural de mettre en doute les conclusions de la division d'opposition en ce qui concerne la requête qu'elle a acceptée (voir point 11 ci-dessus), la présence d'un support dans la demande de brevet telle que déposée pour les anticorps capables de reconnaître spécifiquement un polypeptide selon l'une quelconque des revendications 1 à 5 selon la revendication 27 de la requête acceptée par la division d'opposition, l'objet des revendications 29 à 32, pour autant que de tels anticorps sont visés ou concernés, doit être considéré comme satisfaisant les conditions de la CBE.

43. La division d'opposition avait considéré que la protection conférée par cette revendication en ce qui concerne les anticorps capables de reconnaître spécifiquement un polypeptide selon l'une des revendications 9 et 10 allait au-delà de la protection conférée par la revendication 30 telle que délivrée et lui correspondant qui vise notamment des anticorps monoclonaux ou polyclonaux, anticorps conjugués, ou leurs fragments capables de reconnaître spécifiquement un polypeptide selon l'une quelconque des revendications 9 à 11 telles que délivrées (voir point 2.3 de la décision contestée). L'objection portait non pas sur la désignation des polypeptides reconnus spécifiquement, qui ne pose effectivement pas problème, mais bien sur la nature des anticorps. Les deux revendications soumises à comparaison, la revendication 29 de la requête auxiliaire 7 et la revendication 30 telle que délivrée, diffèrent en ce qui concerne la nature des anticorps de deux manières. En premier lieu, des fragments d'anticorps de toutes sortes sont mentionnés dans ladite revendication 30 alors que seuls des fragments F(ab')2 sont mentionnés dans la dite revendication 29 qui, par conséquent, confère une protection plus restreinte. En second lieu, des anticorps monoclonaux ou polyclonaux sont mentionnés dans la dite revendication 30 alors que des anticorps humanisés sont mentionnés dans ladite revendication 29. Un anticorps humanisé étant par essence un anticorps monoclonal produit par un hybridome généralement d'origine murine et dont a "humanisé" les chaînes VH et VL, ladite revendication 29, par conséquent, confère également pour cet aspect une protection plus restreinte. Il y a donc lieu de considérer que la revendication 29 satisfait les dispositions de l'article 123(3) CBE également pour sa partie qui concerne les anticorps capables de reconnaître spécifiquement un polypeptide selon l'une des revendications 9 et 10. Cette conclusion s'applique pour les mêmes motifs aux revendications 30 à 32.

44. Les lignes 23 à 29 de la page 11 de la demande WO 97/20296 (dont le contenu est celui de la demande de brevet tel que déposé) prises en combinaison avec sa revendication 31 confère à la revendication 29 de la requête auxiliaire 7 le support requis pour que sa partie concernant les anticorps capables de reconnaître spécifiquement un polypeptide selon l'une des revendications 9 et 10 satisfasse les conditions de l'article 123(2) CBE. En se fondant en outre sur les revendications 32 à 34 de la demande WO 97/20926, la même conclusion s'applique aux revendications 30 à 32 de la requête auxiliaire 7.

45. En l'absence de tout commentaire des intimées, la Chambre pour sa part ne voyant aucune raison de former des objections de manque de clarté ou d'insuffisance de description conclut que la revendication 29 satisfait également pour sa partie qui concerne les anticorps capables de reconnaître spécifiquement un polypeptide selon l'une des revendications 9 et 10 les conditions des articles 83 et 84 CBE. La même conclusion s'applique aux revendications 30 à 32 de la requête auxiliaire 7.

46. Etant donné que les polypeptides selon l'une des revendications 9 et 10 sont nouveaux et inventifs, il doit être reconnu que les anticorps de la revendication 29 qui sont capables de reconnaître spécifiquement un tel polypeptide sont eux-mêmes nouveaux et impliquent une activité inventive.

47. La même conclusion vaut également de facto pour la revendication 30 qui vise l'utilisation des anticorps de la revendication 29 pour la purification ou la détection d'un polypeptide, la revendication 31 qui vise un procédé de diagnostic in vitro caractérisé en ce que l'on met en contact au moins un anticorps selon la revendication 29 avec un prélèvement biologique, et la revendication 32 qui vise un kit contenant au moins un tel anticorps.

47.1 La Chambre conclut que les revendications 29 à 32 de la requête auxiliaire 7 satisfont les conditions de la CBE.

Revendication 39

48. La revendication 39 n'est retrouvée telle quelle dans aucune des requêtes sur la base desquelles a été prise la décision contestée et les intimées n'ont fait aucun commentaire à son sujet.

49. La revendication 39 vise l'utilisation d'un polypeptide selon l'une des revendications 1 à 5 ou 9 à 10 pour la préparation d'une composition pharmaceutique (voir section VI ci-dessus). Si elle est à rapprocher de la revendication 37 de la requête auxiliaire acceptée par la division d'opposition (voir section VII(e) ci-dessus), elle correspond en réalité à la revendication 42 telle que délivrée.

50. La protection que confère la revendication 39 est identique à celle que confère la revendication 42 telle que délivrée. La revendication 39 remplit donc les conditions de l'article 123(3) CBE.

51. Les lignes 8 à 15 de la page 4 de la demande WO 97/20296 prises en combinaison avec sa revendication 37 confère à la revendication 39 le support requis pour qu'il soit considéré qu'elle remplit les conditions de l'article 123(2) CBE.

52. En l'absence de tout commentaire des intimées, la Chambre pour sa part ne voyant aucune raison de former des objections de manque de clarté ou d'insuffisance de description conclut que la revendication 39 satisfait les conditions des articles 83 et 84 CBE.

53. Les polypeptides selon les revendications 1 à 5, 9 et 10 étant nouveaux et inventifs (voir le point 29 ci-dessus pour les revendications 1 à 5 et 9 et les points 33 et 34 pour la revendication 10), une même conclusion s'impose pour la revendication 39 qui en vise l'utilisation pour la préparation d'une composition pharmaceutique. La revendication 39 satisfait par conséquent les conditions des articles 54 et 56 CBE.

54. Il est conclu que la revendication 39 de la requête auxiliaire 7 satisfont les conditions de la CBE.

Conclusion

55. Les revendications 1 à 39 de la requête auxiliaire 7 satisfont aux conditions de la CBE. Cette requête peut donc servir de base au maintien du brevet. Ce faisant, il n'y a pas lieu d'examiner les requêtes auxiliaires 8 à 11.

DISPOSITIF

Par ces motifs, il est statué comme suit :

1. La décision attaquée est annulée.

2. L'affaire est renvoyée à la première instance avec l'ordre de maintenir le brevet sous une forme modifiée sur la base des revendications 1 à 39 de la requête auxiliaire 7 remise avec la lettre datée du 3 avril 2009, la description à adapter et les figures à adapter si nécessaire.

3. La requête en remboursement de la taxe de recours est refusée.

Quick Navigation